2077657019_1 - 9 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00002_2077657.. (original name was: 2077657019.a:ASA123_contig00002)

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	T1PKS,butyrolactone,PBDE	1	40,105

c00013_2077657.. (original name was: 2077657019.a:ASA123_contig00013)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	NRPS	60,312	93,436

c00004_2077657.. (original name was: 2077657019.a:ASA123_contig00004)

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	bacteriocin	144,061	155,062

c00027_2077657.. (original name was: 2077657019.a:ASA123_contig00027)

Region	Type	From	To	Most similar known cluster		Similarity
Region 47.1	bacteriocin	1	7,223

c00026_2077657.. (original name was: 2077657019.a:ASA123_contig00026)

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	CDPS	29,649	50,413

c00016_2077657.. (original name was: 2077657019.a:ASA123_contig00016)

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	lassopeptide	67,701	87,793

c00001_2077657.. (original name was: 2077657019.a:ASA123_contig00001)

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	NRPS	291,195	350,457

c00014_2077657.. (original name was: 2077657019.a:ASA123_contig00014)

Region	Type	From	To	Most similar known cluster		Similarity
Region 71.1	ectoine	84,641	93,097

c00005_2077657.. (original name was: 2077657019.a:ASA123_contig00005)

Region	Type	From	To	Most similar known cluster		Similarity
Region 75.1	NRPS	48,771	100,446

Region	Type	From	To	Similarity
Region 29.1	T1PKS,butyrolactone,PBDE	1	40,105
Region 33.1	NRPS	60,312	93,436
Region 46.1	bacteriocin	144,061	155,062
Region 47.1	bacteriocin	1	7,223
Region 53.1	CDPS	29,649	50,413
Region 60.1	lassopeptide	67,701	87,793
Region 67.1	NRPS	291,195	350,457
Region 71.1	ectoine	84,641	93,097
Region 75.1	NRPS	48,771	100,446

No secondary metabolite regions were found in these records:: c00083_2077657.. (original name was: 2077657019.a:ASA123_contig00083); c00087_2077657.. (original name was: 2077657019.a:ASA123_contig00087); c00035_2077657.. (original name was: 2077657019.a:ASA123_contig00035); c00032_2077657.. (original name was: 2077657019.a:ASA123_contig00032); c00038_2077657.. (original name was: 2077657019.a:ASA123_contig00038); c00040_2077657.. (original name was: 2077657019.a:ASA123_contig00040); c00021_2077657.. (original name was: 2077657019.a:ASA123_contig00021); c00024_2077657.. (original name was: 2077657019.a:ASA123_contig00024); c00054_2077657.. (original name was: 2077657019.a:ASA123_contig00054); c00057_2077657.. (original name was: 2077657019.a:ASA123_contig00057); c00067_2077657.. (original name was: 2077657019.a:ASA123_contig00067); c00008_2077657.. (original name was: 2077657019.a:ASA123_contig00008); c00025_2077657.. (original name was: 2077657019.a:ASA123_contig00025); c00028_2077657.. (original name was: 2077657019.a:ASA123_contig00028); c00047_2077657.. (original name was: 2077657019.a:ASA123_contig00047); c00006_2077657.. (original name was: 2077657019.a:ASA123_contig00006); c00058_2077657.. (original name was: 2077657019.a:ASA123_contig00058); c00060_2077657.. (original name was: 2077657019.a:ASA123_contig00060); c00036_2077657.. (original name was: 2077657019.a:ASA123_contig00036); c00039_2077657.. (original name was: 2077657019.a:ASA123_contig00039); c00030_2077657.. (original name was: 2077657019.a:ASA123_contig00030); c00033_2077657.. (original name was: 2077657019.a:ASA123_contig00033); c00007_2077657.. (original name was: 2077657019.a:ASA123_contig00007); c00062_2077657.. (original name was: 2077657019.a:ASA123_contig00062); c00010_2077657.. (original name was: 2077657019.a:ASA123_contig00010); c00015_2077657.. (original name was: 2077657019.a:ASA123_contig00015); c00045_2077657.. (original name was: 2077657019.a:ASA123_contig00045); c00048_2077657.. (original name was: 2077657019.a:ASA123_contig00048); c00003_2077657.. (original name was: 2077657019.a:ASA123_contig00003); c00022_2077657.. (original name was: 2077657019.a:ASA123_contig00022); c00080_2077657.. (original name was: 2077657019.a:ASA123_contig00080); c00065_2077657.. (original name was: 2077657019.a:ASA123_contig00065); c00073_2077657.. (original name was: 2077657019.a:ASA123_contig00073); c00070_2077657.. (original name was: 2077657019.a:ASA123_contig00070); c00079_2077657.. (original name was: 2077657019.a:ASA123_contig00079); c00009_2077657.. (original name was: 2077657019.a:ASA123_contig00009); c00082_2077657.. (original name was: 2077657019.a:ASA123_contig00082); c00072_2077657.. (original name was: 2077657019.a:ASA123_contig00072); c00075_2077657.. (original name was: 2077657019.a:ASA123_contig00075); c00052_2077657.. (original name was: 2077657019.a:ASA123_contig00052); c00055_2077657.. (original name was: 2077657019.a:ASA123_contig00055); c00046_2077657.. (original name was: 2077657019.a:ASA123_contig00046); c00043_2077657.. (original name was: 2077657019.a:ASA123_contig00043); c00071_2077657.. (original name was: 2077657019.a:ASA123_contig00071); c00069_2077657.. (original name was: 2077657019.a:ASA123_contig00069); c00074_2077657.. (original name was: 2077657019.a:ASA123_contig00074); c00077_2077657.. (original name was: 2077657019.a:ASA123_contig00077); c00023_2077657.. (original name was: 2077657019.a:ASA123_contig00023); c00051_2077657.. (original name was: 2077657019.a:ASA123_contig00051); c00049_2077657.. (original name was: 2077657019.a:ASA123_contig00049); c00050_2077657.. (original name was: 2077657019.a:ASA123_contig00050); c00053_2077657.. (original name was: 2077657019.a:ASA123_contig00053); c00059_2077657.. (original name was: 2077657019.a:ASA123_contig00059); c00056_2077657.. (original name was: 2077657019.a:ASA123_contig00056); c00031_2077657.. (original name was: 2077657019.a:ASA123_contig00031); c00029_2077657.. (original name was: 2077657019.a:ASA123_contig00029); c00018_2077657.. (original name was: 2077657019.a:ASA123_contig00018); c00064_2077657.. (original name was: 2077657019.a:ASA123_contig00064); c00061_2077657.. (original name was: 2077657019.a:ASA123_contig00061); c00020_2077657.. (original name was: 2077657019.a:ASA123_contig00020); c00011_2077657.. (original name was: 2077657019.a:ASA123_contig00011); c00037_2077657.. (original name was: 2077657019.a:ASA123_contig00037); c00034_2077657.. (original name was: 2077657019.a:ASA123_contig00034); c00044_2077657.. (original name was: 2077657019.a:ASA123_contig00044); c00041_2077657.. (original name was: 2077657019.a:ASA123_contig00041); c00042_2077657.. (original name was: 2077657019.a:ASA123_contig00042); c00019_2077657.. (original name was: 2077657019.a:ASA123_contig00019); c00063_2077657.. (original name was: 2077657019.a:ASA123_contig00063); c00066_2077657.. (original name was: 2077657019.a:ASA123_contig00066); c00017_2077657.. (original name was: 2077657019.a:ASA123_contig00017); c00012_2077657.. (original name was: 2077657019.a:ASA123_contig00012)

Compact view

c00002_2077657.. - Region 1 - PBDE,T1PKS,butyrolactone

Download region GenBank file

Location: 1 - 40,105 nt. (total: 40,105 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA
PBDE: (FMO-like and p450 and DUF98)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 40105:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 32773:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg29_12

PKS_AT (559..858): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; CE-Malonyl-CoA: 66.7%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 97.1
Methoxymalonyl-CoA: 91.6
Malonyl-CoA: 82.5
Ethylmalonyl-CoA: 73.7
trans-1,2-CPDA: 65.2
Propionyl-CoA: 52.2
Isobutyryl-CoA: 50.2
Acetyl-CoA: 50.1
3-Methylbutyryl-CoA: 38.2
2-Methylbutyryl-CoA: 37.1
fatty_acid: 31.3
Benzoyl-CoA: 30.3
inactive: 29.5
CHC-CoA: 25.3

ctg29_23

Search NORINE for peptide: strict or relaxed

AMP-binding (16..417): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLfYiAfV-K
Nearest Stachelhaus code:: iva
Stachelhaus code match:: 60% (weak)

c00013_2077657.. - Region 1 - NRPS

Download region GenBank file

Location: 60,312 - 93,436 nt. (total: 33,125 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 60311 - 93436:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg33_82

Search NORINE for peptide: strict or relaxed

AMP-binding (501..919): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsWdFGyVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

AMP-binding (2164..2582): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00004_2077657.. - Region 1 - bacteriocin

Download region GenBank file

Location: 144,061 - 155,062 nt. (total: 11,002 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00027_2077657.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 7,223 nt. (total: 7,223 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00026_2077657.. - Region 1 - CDPS

Download region GenBank file

Location: 29,649 - 50,413 nt. (total: 20,765 nt) Show pHMM detection rules used

CDPS: (CDPS or cycdipepsynth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00016_2077657.. - Region 1 - lassopeptide

Download region GenBank file

Location: 67,701 - 87,793 nt. (total: 20,093 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for ctg60_70 - Putative Class II

ctg60_70 leader / core peptide / cleaved tail: MSDIDVNTLLSEDKNSKKSLGDKLIWVAPVLEELETDKTR - SGGGTATETPFNPGVSS

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

ctg60_70 - Class II: Cleavage pHMM score: -12.50; RODEO score: 16; Monoisotopic mass: 1546.7 Da; Molecular weight: 1547.6 Da; Number of bridges: 0

c00001_2077657.. - Region 1 - NRPS

Download region GenBank file

Location: 291,195 - 350,457 nt. (total: 59,263 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 291194 - 350457:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp) + (X - X - gly) + (X - gly) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg67_301

Search NORINE for peptide: strict or relaxed

AMP-binding (450..882): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg67_302

Search NORINE for peptide: strict or relaxed

AMP-binding (537..972): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1792..2205): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

ctg67_303

Search NORINE for peptide: strict or relaxed

AMP-binding (497..935): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

AMP-binding (1627..2070): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIvQiGgVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

AMP-binding (2772..3186): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DmLQVGavWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

ctg67_304

Search NORINE for peptide: strict or relaxed

AMP-binding (529..941): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg67_305

CAL_domain (168..478): pk

minowa: NH2

Prediction, score:

NH2: 91.7
Acetyl-CoA: 37.0
fatty_acid: 36.6
AHBA: 20.3
shikimic_acid: 0.0

c00014_2077657.. - Region 1 - ectoine

Download region GenBank file

Location: 84,641 - 93,097 nt. (total: 8,457 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00005_2077657.. - Region 1 - NRPS

Download region GenBank file

Location: 48,771 - 100,446 nt. (total: 51,676 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains