3300005985_16 - 10 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00012_3300005.. (original name was: 3300005985.a:Ga0081539_10005279)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	NRPS	1	13,316

c00013_3300005.. (original name was: 3300005985.a:Ga0081539_10003361)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	NRPS-like	1	19,802

c00020_3300005.. (original name was: 3300005985.a:Ga0081539_10000738)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	NRPS,T1PKS	1	65,428

c00022_3300005.. (original name was: 3300005985.a:Ga0081539_10000063)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	bacteriocin	26,713	42,855
Region 22.2	NRPS	218,258	248,201

c00033_3300005.. (original name was: 3300005985.a:Ga0081539_10000360)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	lanthipeptide	32,681	55,929

c00045_3300005.. (original name was: 3300005985.a:Ga0081539_10000149)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS-like	13,459	57,904

c00069_3300005.. (original name was: 3300005985.a:Ga0081539_10000323)

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	NRPS,T1PKS	68,486	106,662

c00072_3300005.. (original name was: 3300005985.a:Ga0081539_10000557)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	bacteriocin	43,730	55,574

c00086_3300005.. (original name was: 3300005985.a:Ga0081539_10000307)

Region	Type	From	To	Most similar known cluster		Similarity
Region 86.1	NRPS,T1PKS	25,813	109,928

Region	Type	From	To	Similarity
Region 12.1	NRPS	1	13,316
Region 13.1	NRPS-like	1	19,802
Region 20.1	NRPS,T1PKS	1	65,428
Region 22.1	bacteriocin	26,713	42,855
Region 22.2	NRPS	218,258	248,201
Region 33.1	lanthipeptide	32,681	55,929
Region 45.1	NRPS-like	13,459	57,904
Region 69.1	NRPS,T1PKS	68,486	106,662
Region 72.1	bacteriocin	43,730	55,574
Region 86.1	NRPS,T1PKS	25,813	109,928

No secondary metabolite regions were found in these records:: c00001_3300005.. (original name was: 3300005985.a:Ga0081539_10027792); c00002_3300005.. (original name was: 3300005985.a:Ga0081539_10028524); c00003_3300005.. (original name was: 3300005985.a:Ga0081539_10014803); c00004_3300005.. (original name was: 3300005985.a:Ga0081539_10011469); c00005_3300005.. (original name was: 3300005985.a:Ga0081539_10018681); c00006_3300005.. (original name was: 3300005985.a:Ga0081539_10025004); c00007_3300005.. (original name was: 3300005985.a:Ga0081539_10000820); c00008_3300005.. (original name was: 3300005985.a:Ga0081539_10013834); c00009_3300005.. (original name was: 3300005985.a:Ga0081539_10019978); c00010_3300005.. (original name was: 3300005985.a:Ga0081539_10002274); c00011_3300005.. (original name was: 3300005985.a:Ga0081539_10009889); c00014_3300005.. (original name was: 3300005985.a:Ga0081539_10000514); c00015_3300005.. (original name was: 3300005985.a:Ga0081539_10000239); c00016_3300005.. (original name was: 3300005985.a:Ga0081539_10002577); c00017_3300005.. (original name was: 3300005985.a:Ga0081539_10000654); c00018_3300005.. (original name was: 3300005985.a:Ga0081539_10000053); c00019_3300005.. (original name was: 3300005985.a:Ga0081539_10011509); c00021_3300005.. (original name was: 3300005985.a:Ga0081539_10001252); c00023_3300005.. (original name was: 3300005985.a:Ga0081539_10000571); c00024_3300005.. (original name was: 3300005985.a:Ga0081539_10001510); c00025_3300005.. (original name was: 3300005985.a:Ga0081539_10026795); c00026_3300005.. (original name was: 3300005985.a:Ga0081539_10003302); c00027_3300005.. (original name was: 3300005985.a:Ga0081539_10027172); c00028_3300005.. (original name was: 3300005985.a:Ga0081539_10001057); c00029_3300005.. (original name was: 3300005985.a:Ga0081539_10016871); c00030_3300005.. (original name was: 3300005985.a:Ga0081539_10028702); c00031_3300005.. (original name was: 3300005985.a:Ga0081539_10000049); c00032_3300005.. (original name was: 3300005985.a:Ga0081539_10000510); c00034_3300005.. (original name was: 3300005985.a:Ga0081539_10001941); c00035_3300005.. (original name was: 3300005985.a:Ga0081539_10001165); c00036_3300005.. (original name was: 3300005985.a:Ga0081539_10000502); c00037_3300005.. (original name was: 3300005985.a:Ga0081539_10000022); c00038_3300005.. (original name was: 3300005985.a:Ga0081539_10003679); c00039_3300005.. (original name was: 3300005985.a:Ga0081539_10004670); c00040_3300005.. (original name was: 3300005985.a:Ga0081539_10000660); c00041_3300005.. (original name was: 3300005985.a:Ga0081539_10000742); c00042_3300005.. (original name was: 3300005985.a:Ga0081539_10001904); c00043_3300005.. (original name was: 3300005985.a:Ga0081539_10004387); c00044_3300005.. (original name was: 3300005985.a:Ga0081539_10000591); c00046_3300005.. (original name was: 3300005985.a:Ga0081539_10000230); c00047_3300005.. (original name was: 3300005985.a:Ga0081539_10000658); c00048_3300005.. (original name was: 3300005985.a:Ga0081539_10000156); c00049_3300005.. (original name was: 3300005985.a:Ga0081539_10007785); c00050_3300005.. (original name was: 3300005985.a:Ga0081539_10021564); c00051_3300005.. (original name was: 3300005985.a:Ga0081539_10020455); c00052_3300005.. (original name was: 3300005985.a:Ga0081539_10002080); c00053_3300005.. (original name was: 3300005985.a:Ga0081539_10000871); c00054_3300005.. (original name was: 3300005985.a:Ga0081539_10001334); c00055_3300005.. (original name was: 3300005985.a:Ga0081539_10001523); c00056_3300005.. (original name was: 3300005985.a:Ga0081539_10004301); c00057_3300005.. (original name was: 3300005985.a:Ga0081539_10001819); c00058_3300005.. (original name was: 3300005985.a:Ga0081539_10000666); c00059_3300005.. (original name was: 3300005985.a:Ga0081539_10012357); c00060_3300005.. (original name was: 3300005985.a:Ga0081539_10014130); c00061_3300005.. (original name was: 3300005985.a:Ga0081539_10001170); c00062_3300005.. (original name was: 3300005985.a:Ga0081539_10000592); c00063_3300005.. (original name was: 3300005985.a:Ga0081539_10016056); c00064_3300005.. (original name was: 3300005985.a:Ga0081539_10000165); c00065_3300005.. (original name was: 3300005985.a:Ga0081539_10000275); c00066_3300005.. (original name was: 3300005985.a:Ga0081539_10009530); c00067_3300005.. (original name was: 3300005985.a:Ga0081539_10000755); c00068_3300005.. (original name was: 3300005985.a:Ga0081539_10029525); c00070_3300005.. (original name was: 3300005985.a:Ga0081539_10014171); c00071_3300005.. (original name was: 3300005985.a:Ga0081539_10000033); c00073_3300005.. (original name was: 3300005985.a:Ga0081539_10009218); c00074_3300005.. (original name was: 3300005985.a:Ga0081539_10000073); c00075_3300005.. (original name was: 3300005985.a:Ga0081539_10004100); c00076_3300005.. (original name was: 3300005985.a:Ga0081539_10001519); c00077_3300005.. (original name was: 3300005985.a:Ga0081539_10000614); c00078_3300005.. (original name was: 3300005985.a:Ga0081539_10001830); c00079_3300005.. (original name was: 3300005985.a:Ga0081539_10000533); c00080_3300005.. (original name was: 3300005985.a:Ga0081539_10012524); c00081_3300005.. (original name was: 3300005985.a:Ga0081539_10010635); c00082_3300005.. (original name was: 3300005985.a:Ga0081539_10000110); c00083_3300005.. (original name was: 3300005985.a:Ga0081539_10000201); c00084_3300005.. (original name was: 3300005985.a:Ga0081539_10004753); c00085_3300005.. (original name was: 3300005985.a:Ga0081539_10000554); c00087_3300005.. (original name was: 3300005985.a:Ga0081539_10000450); c00088_3300005.. (original name was: 3300005985.a:Ga0081539_10000145); c00089_3300005.. (original name was: 3300005985.a:Ga0081539_10001250); c00090_3300005.. (original name was: 3300005985.a:Ga0081539_10000344); c00091_3300005.. (original name was: 3300005985.a:Ga0081539_10000130); c00092_3300005.. (original name was: 3300005985.a:Ga0081539_10001433); c00093_3300005.. (original name was: 3300005985.a:Ga0081539_10000731)

Compact view

c00012_3300005.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,316 nt. (total: 13,316 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13316:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg12_1

Search NORINE for peptide: strict or relaxed

AMP-binding (495..848): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg12_2

Search NORINE for peptide: strict or relaxed

AMP-binding (496..896): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1903..2295): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2956..3360): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

c00013_3300005.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 19,802 nt. (total: 19,802 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 19802:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_11

Search NORINE for peptide: strict or relaxed

AMP-binding (27..436): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vFmvvGgAlK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 40% (weak)

c00020_3300005.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 65,428 nt. (total: 65,428 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 65428:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala) + (X) + (gln - asn) + (thr - gln) + (D-X) + (glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_17

CAL_domain (163..503): pk

minowa: NH2

Prediction, score:

NH2: 167.4
Acetyl-CoA: 73.8
AHBA: 24.6
shikimic_acid: 11.0
fatty_acid: 8.0

ctg20_19

Search NORINE for peptide: strict or relaxed

AMP-binding (469..868): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DVrrFGtvNK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

ctg20_22

Search NORINE for peptide: strict or relaxed

AMP-binding (2115..2530): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

ctg20_23

PKS_AT (536..833): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.0
inactive: 120.1
Methoxymalonyl-CoA: 77.0
Methylmalonyl-CoA: 53.9
Propionyl-CoA: 43.1
Ethylmalonyl-CoA: 41.0
Isobutyryl-CoA: 33.9
2-Methylbutyryl-CoA: 33.9
CHC-CoA: 29.7
Benzoyl-CoA: 23.8
Acetyl-CoA: 18.9
trans-1,2-CPDA: 17.4
fatty_acid: 12.7
3-Methylbutyryl-CoA: 12.2

ctg20_24

Search NORINE for peptide: strict or relaxed

AMP-binding (510..916): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1591..1990): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQwGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

ctg20_25

Search NORINE for peptide: strict or relaxed

AMP-binding (467..866): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQwGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

AMP-binding (1813..2215): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg20_27

Search NORINE for peptide: strict or relaxed

AMP-binding (9..421): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLmtK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

ctg20_29

Search NORINE for peptide: strict or relaxed

AMP-binding (507..899): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00022_3300005.. - Region 1 - bacteriocin

Download region GenBank file

Location: 26,713 - 42,855 nt. (total: 16,143 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00022_3300005.. - Region 2 - NRPS

Download region GenBank file

Location: 218,258 - 248,201 nt. (total: 29,944 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 218257 - 248201:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_171

Search NORINE for peptide: strict or relaxed

CAL_domain (58..507): pk

minowa: NH2

Prediction, score:

NH2: 214.7
fatty_acid: 28.2
AHBA: 12.9
Acetyl-CoA: 0.3
shikimic_acid: 0.0

AMP-binding (1184..1576): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2235..2650): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

c00033_3300005.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 32,681 - 55,929 nt. (total: 23,249 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg33_35 - Putative Class II

ctg33_33 leader / core peptide: MQLLEGERLEVNEA - EAPWKKDhaDhbQDhaLADhbRPRRCQ
ctg33_36 leader / core peptide: MSQADIIRAWKDPLYRKGLSSAELAALPENPAGRVELTDDELDGS - DDhbLLADhbDhbYADhbCDhbCDhbDhbADhbRQIDhbCP
allorf_046632_046868 leader / core peptide: VEQHILLLAVVHSTPDPVSVATLTGA - HLRDFILDhbCHPVAARCADDhaCVAPAAVIKKQPRDhbIAPLPDhbPGGLDRACMIDhaGL
allorf_052344_052508 leader / core peptide: VPHRRIEAQKSCREARVAPGA - ADhbVGPKRHARDhaKDhbRLGRADhaPHAVHARKCPLQEV
allorf_032898_033032 leader / core peptide: MGRQGAPQRHRGHGGGTEDQSSLRA - DhaDhaVRDhaVPLWCDhbAARRNFCG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg33_33 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 2170.2 Da

Molecular weight: 2171.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2189.5 Da N = 1; 2207.5 Da N = 2; 2225.5 Da N = 3

ctg33_36 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 2286.1 Da

Molecular weight: 2287.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2305.6 Da N = 1; 2323.6 Da N = 2; 2341.7 Da N = 3; 2359.7 Da N = 4; 2377.7 Da N = 5; 2395.7 Da N = 6

allorf_046632_046868 - Class II

Cleavage pHMM score: -5.80

RODEO score: 0

Monoisotopic mass: 5359.9 Da

Molecular weight: 5363.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 5381.4 Da N = 1

allorf_052344_052508 - Class II

Cleavage pHMM score: -1.20

RODEO score: 0

Monoisotopic mass: 3542.0 Da

Molecular weight: 3544.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3562.1 Da N = 1; 3580.1 Da N = 2; 3598.2 Da N = 3

allorf_032898_033032 - Class II

Cleavage pHMM score: -5.80

RODEO score: 0

Monoisotopic mass: 2037.0 Da

Molecular weight: 2038.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2056.4 Da N = 1; 2074.4 Da N = 2

c00045_3300005.. - Region 1 - NRPS-like

Download region GenBank file

Location: 13,459 - 57,904 nt. (total: 44,446 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 13458 - 57904:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg45_36

Search NORINE for peptide: strict or relaxed

AMP-binding (562..1000): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eFtviGGpVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

c00069_3300005.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 68,486 - 106,662 nt. (total: 38,177 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 68485 - 106662:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X) + (ohmal) + (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg69_67

Search NORINE for peptide: strict or relaxed

AMP-binding (518..913): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg69_69

PKS_AT (533..831): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.4
inactive: 119.1
Methoxymalonyl-CoA: 85.2
Methylmalonyl-CoA: 64.7
Propionyl-CoA: 53.2
CHC-CoA: 42.8
Isobutyryl-CoA: 41.9
Ethylmalonyl-CoA: 41.1
2-Methylbutyryl-CoA: 39.4
Acetyl-CoA: 29.3
Benzoyl-CoA: 26.6
trans-1,2-CPDA: 16.7
fatty_acid: 15.8
3-Methylbutyryl-CoA: 8.4

ctg69_70

Search NORINE for peptide: strict or relaxed

AMP-binding (506..913): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1587..1990): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

c00072_3300005.. - Region 1 - bacteriocin

Download region GenBank file

Location: 43,730 - 55,574 nt. (total: 11,845 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00086_3300005.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 25,813 - 109,928 nt. (total: 84,116 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 25812 - 109928:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - X) + (ser - ala) + (X - ala) + (leu - pro - cys) + (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg86_39

Search NORINE for peptide: strict or relaxed

AMP-binding (524..927): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHLGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

ctg86_41

PKS_AT (535..833): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.2
inactive: 111.1
Methoxymalonyl-CoA: 84.4
Methylmalonyl-CoA: 74.8
Propionyl-CoA: 51.7
Ethylmalonyl-CoA: 43.6
Isobutyryl-CoA: 38.1
2-Methylbutyryl-CoA: 35.5
Benzoyl-CoA: 27.9
CHC-CoA: 23.4
trans-1,2-CPDA: 20.3
Acetyl-CoA: 17.2
3-Methylbutyryl-CoA: 11.5
fatty_acid: 10.6

ctg86_43

Search NORINE for peptide: strict or relaxed

AMP-binding (511..911): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWhLGfigK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (1574..1979): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHLAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 100% (strong)

AMP-binding (3028..3317): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

ctg86_44

Search NORINE for peptide: strict or relaxed

CAL_domain (48..494): pk

minowa: NH2

Prediction, score:

NH2: 216.9
Acetyl-CoA: 64.0
AHBA: 25.4
fatty_acid: 12.2
shikimic_acid: 3.0

AMP-binding (1173..1578): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTvVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (2269..2662): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg86_49

Search NORINE for peptide: strict or relaxed

AMP-binding (489..889): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1918..2311): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg86_50

Search NORINE for peptide: strict or relaxed

AMP-binding (510..906): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1992..2397): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)