3300006322_3 - 11 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300006.. (original name was: 3300006322.a:Ga0099623_1001749)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	ladderane,arylpolyene	1	11,370

c00002_3300006.. (original name was: 3300006322.a:Ga0099623_1000184)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	1	42,509

c00012_3300006.. (original name was: 3300006322.a:Ga0099623_1000517)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	LAP	2,443	23,926

c00022_3300006.. (original name was: 3300006322.a:Ga0099623_1000402)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	lanthipeptide	1	21,108

c00044_3300006.. (original name was: 3300006322.a:Ga0099623_1000398)

Region	Type	From	To	Most similar known cluster		Similarity
Region 44.1	bacteriocin	4,214	14,519

c00068_3300006.. (original name was: 3300006322.a:Ga0099623_1003873)

Region	Type	From	To	Most similar known cluster		Similarity
Region 68.1	LAP	1	6,613

c00106_3300006.. (original name was: 3300006322.a:Ga0099623_1001600)

Region	Type	From	To	Most similar known cluster		Similarity
Region 106.1	lanthipeptide	1	11,982

c00125_3300006.. (original name was: 3300006322.a:Ga0099623_1000197)

Region	Type	From	To	Most similar known cluster		Similarity
Region 125.1	lanthipeptide	1	18,906
Region 125.2	LAP	24,011	41,097

c00139_3300006.. (original name was: 3300006322.a:Ga0099623_1000196)

Region	Type	From	To	Most similar known cluster		Similarity
Region 139.1	NRPS	1	41,144

c00153_3300006.. (original name was: 3300006322.a:Ga0099623_1000050)

Region	Type	From	To	Most similar known cluster		Similarity
Region 153.1	NRPS	1	38,822

Region	Type	From	To	Similarity
Region 1.1	ladderane,arylpolyene	1	11,370
Region 2.1	NRPS	1	42,509
Region 12.1	LAP	2,443	23,926
Region 22.1	lanthipeptide	1	21,108
Region 44.1	bacteriocin	4,214	14,519
Region 68.1	LAP	1	6,613
Region 106.1	lanthipeptide	1	11,982
Region 125.1	lanthipeptide	1	18,906
Region 125.2	LAP	24,011	41,097
Region 139.1	NRPS	1	41,144
Region 153.1	NRPS	1	38,822

No secondary metabolite regions were found in these records:: c00003_3300006.. (original name was: 3300006322.a:Ga0099623_1000993); c00004_3300006.. (original name was: 3300006322.a:Ga0099623_1007619); c00005_3300006.. (original name was: 3300006322.a:Ga0099623_1002088); c00006_3300006.. (original name was: 3300006322.a:Ga0099623_1005348); c00007_3300006.. (original name was: 3300006322.a:Ga0099623_1005137); c00008_3300006.. (original name was: 3300006322.a:Ga0099623_1006152); c00009_3300006.. (original name was: 3300006322.a:Ga0099623_1007817); c00010_3300006.. (original name was: 3300006322.a:Ga0099623_1004736); c00011_3300006.. (original name was: 3300006322.a:Ga0099623_1008263); c00013_3300006.. (original name was: 3300006322.a:Ga0099623_1009199); c00014_3300006.. (original name was: 3300006322.a:Ga0099623_1010352); c00015_3300006.. (original name was: 3300006322.a:Ga0099623_1007899); c00016_3300006.. (original name was: 3300006322.a:Ga0099623_1003501); c00017_3300006.. (original name was: 3300006322.a:Ga0099623_1002325); c00018_3300006.. (original name was: 3300006322.a:Ga0099623_1004665); c00019_3300006.. (original name was: 3300006322.a:Ga0099623_1005843); c00020_3300006.. (original name was: 3300006322.a:Ga0099623_1003404); c00021_3300006.. (original name was: 3300006322.a:Ga0099623_1001271); c00023_3300006.. (original name was: 3300006322.a:Ga0099623_1000365); c00024_3300006.. (original name was: 3300006322.a:Ga0099623_1003398); c00025_3300006.. (original name was: 3300006322.a:Ga0099623_1000446); c00026_3300006.. (original name was: 3300006322.a:Ga0099623_1001567); c00027_3300006.. (original name was: 3300006322.a:Ga0099623_1000525); c00028_3300006.. (original name was: 3300006322.a:Ga0099623_1000848); c00029_3300006.. (original name was: 3300006322.a:Ga0099623_1000294); c00030_3300006.. (original name was: 3300006322.a:Ga0099623_1000378); c00031_3300006.. (original name was: 3300006322.a:Ga0099623_1001037); c00032_3300006.. (original name was: 3300006322.a:Ga0099623_1000886); c00033_3300006.. (original name was: 3300006322.a:Ga0099623_1003394); c00034_3300006.. (original name was: 3300006322.a:Ga0099623_1000945); c00035_3300006.. (original name was: 3300006322.a:Ga0099623_1000450); c00036_3300006.. (original name was: 3300006322.a:Ga0099623_1000501); c00037_3300006.. (original name was: 3300006322.a:Ga0099623_1000111); c00038_3300006.. (original name was: 3300006322.a:Ga0099623_1000548); c00039_3300006.. (original name was: 3300006322.a:Ga0099623_1000347); c00040_3300006.. (original name was: 3300006322.a:Ga0099623_1001539); c00041_3300006.. (original name was: 3300006322.a:Ga0099623_1002182); c00042_3300006.. (original name was: 3300006322.a:Ga0099623_1000344); c00043_3300006.. (original name was: 3300006322.a:Ga0099623_1000186); c00045_3300006.. (original name was: 3300006322.a:Ga0099623_1001238); c00046_3300006.. (original name was: 3300006322.a:Ga0099623_1001090); c00047_3300006.. (original name was: 3300006322.a:Ga0099623_1001126); c00048_3300006.. (original name was: 3300006322.a:Ga0099623_1000914); c00049_3300006.. (original name was: 3300006322.a:Ga0099623_1005841); c00050_3300006.. (original name was: 3300006322.a:Ga0099623_1001206); c00051_3300006.. (original name was: 3300006322.a:Ga0099623_1000241); c00052_3300006.. (original name was: 3300006322.a:Ga0099623_1000062); c00053_3300006.. (original name was: 3300006322.a:Ga0099623_1000061); c00054_3300006.. (original name was: 3300006322.a:Ga0099623_1000328); c00055_3300006.. (original name was: 3300006322.a:Ga0099623_1000127); c00056_3300006.. (original name was: 3300006322.a:Ga0099623_1003901); c00057_3300006.. (original name was: 3300006322.a:Ga0099623_1001359); c00058_3300006.. (original name was: 3300006322.a:Ga0099623_1000866); c00059_3300006.. (original name was: 3300006322.a:Ga0099623_1002459); c00060_3300006.. (original name was: 3300006322.a:Ga0099623_1000608); c00061_3300006.. (original name was: 3300006322.a:Ga0099623_1000869); c00062_3300006.. (original name was: 3300006322.a:Ga0099623_1000264); c00063_3300006.. (original name was: 3300006322.a:Ga0099623_1000300); c00064_3300006.. (original name was: 3300006322.a:Ga0099623_1003481); c00065_3300006.. (original name was: 3300006322.a:Ga0099623_1000901); c00066_3300006.. (original name was: 3300006322.a:Ga0099623_1002490); c00067_3300006.. (original name was: 3300006322.a:Ga0099623_1000781); c00069_3300006.. (original name was: 3300006322.a:Ga0099623_1000531); c00070_3300006.. (original name was: 3300006322.a:Ga0099623_1003623); c00071_3300006.. (original name was: 3300006322.a:Ga0099623_1004442); c00072_3300006.. (original name was: 3300006322.a:Ga0099623_1001862); c00073_3300006.. (original name was: 3300006322.a:Ga0099623_1003098); c00074_3300006.. (original name was: 3300006322.a:Ga0099623_1004305); c00075_3300006.. (original name was: 3300006322.a:Ga0099623_1000729); c00076_3300006.. (original name was: 3300006322.a:Ga0099623_1009790); c00077_3300006.. (original name was: 3300006322.a:Ga0099623_1000309); c00078_3300006.. (original name was: 3300006322.a:Ga0099623_1008001); c00079_3300006.. (original name was: 3300006322.a:Ga0099623_1007407); c00080_3300006.. (original name was: 3300006322.a:Ga0099623_1002157); c00081_3300006.. (original name was: 3300006322.a:Ga0099623_1001015); c00082_3300006.. (original name was: 3300006322.a:Ga0099623_1002978); c00083_3300006.. (original name was: 3300006322.a:Ga0099623_1000912); c00084_3300006.. (original name was: 3300006322.a:Ga0099623_1000345); c00085_3300006.. (original name was: 3300006322.a:Ga0099623_1002648); c00086_3300006.. (original name was: 3300006322.a:Ga0099623_1000367); c00087_3300006.. (original name was: 3300006322.a:Ga0099623_1003440); c00088_3300006.. (original name was: 3300006322.a:Ga0099623_1003545); c00089_3300006.. (original name was: 3300006322.a:Ga0099623_1000640); c00090_3300006.. (original name was: 3300006322.a:Ga0099623_1001772); c00091_3300006.. (original name was: 3300006322.a:Ga0099623_1001058); c00092_3300006.. (original name was: 3300006322.a:Ga0099623_1001384); c00093_3300006.. (original name was: 3300006322.a:Ga0099623_1001621); c00094_3300006.. (original name was: 3300006322.a:Ga0099623_1000762); c00095_3300006.. (original name was: 3300006322.a:Ga0099623_1002679); c00096_3300006.. (original name was: 3300006322.a:Ga0099623_1001671); c00097_3300006.. (original name was: 3300006322.a:Ga0099623_1000991); c00098_3300006.. (original name was: 3300006322.a:Ga0099623_1003629); c00099_3300006.. (original name was: 3300006322.a:Ga0099623_1001578); c00100_3300006.. (original name was: 3300006322.a:Ga0099623_1004522); c00101_3300006.. (original name was: 3300006322.a:Ga0099623_1004526); c00102_3300006.. (original name was: 3300006322.a:Ga0099623_1000095); c00103_3300006.. (original name was: 3300006322.a:Ga0099623_1002527); c00104_3300006.. (original name was: 3300006322.a:Ga0099623_1001118); c00105_3300006.. (original name was: 3300006322.a:Ga0099623_1001458); c00107_3300006.. (original name was: 3300006322.a:Ga0099623_1009526); c00108_3300006.. (original name was: 3300006322.a:Ga0099623_1000115); c00109_3300006.. (original name was: 3300006322.a:Ga0099623_1000275); c00110_3300006.. (original name was: 3300006322.a:Ga0099623_1000793); c00111_3300006.. (original name was: 3300006322.a:Ga0099623_1001293); c00112_3300006.. (original name was: 3300006322.a:Ga0099623_1000506); c00113_3300006.. (original name was: 3300006322.a:Ga0099623_1000146); c00114_3300006.. (original name was: 3300006322.a:Ga0099623_1000777); c00115_3300006.. (original name was: 3300006322.a:Ga0099623_1000838); c00116_3300006.. (original name was: 3300006322.a:Ga0099623_1000644); c00117_3300006.. (original name was: 3300006322.a:Ga0099623_1008791); c00118_3300006.. (original name was: 3300006322.a:Ga0099623_1001157); c00119_3300006.. (original name was: 3300006322.a:Ga0099623_1000090); c00120_3300006.. (original name was: 3300006322.a:Ga0099623_1000881); c00121_3300006.. (original name was: 3300006322.a:Ga0099623_1005063); c00122_3300006.. (original name was: 3300006322.a:Ga0099623_1006187); c00123_3300006.. (original name was: 3300006322.a:Ga0099623_1001430); c00124_3300006.. (original name was: 3300006322.a:Ga0099623_1000145); c00126_3300006.. (original name was: 3300006322.a:Ga0099623_1001025); c00127_3300006.. (original name was: 3300006322.a:Ga0099623_1003407); c00128_3300006.. (original name was: 3300006322.a:Ga0099623_1006665); c00129_3300006.. (original name was: 3300006322.a:Ga0099623_1000998); c00130_3300006.. (original name was: 3300006322.a:Ga0099623_1000973); c00131_3300006.. (original name was: 3300006322.a:Ga0099623_1000193); c00132_3300006.. (original name was: 3300006322.a:Ga0099623_1001636); c00133_3300006.. (original name was: 3300006322.a:Ga0099623_1000069); c00134_3300006.. (original name was: 3300006322.a:Ga0099623_1000199); c00135_3300006.. (original name was: 3300006322.a:Ga0099623_1002528); c00136_3300006.. (original name was: 3300006322.a:Ga0099623_1000227); c00137_3300006.. (original name was: 3300006322.a:Ga0099623_1005268); c00138_3300006.. (original name was: 3300006322.a:Ga0099623_1001447); c00140_3300006.. (original name was: 3300006322.a:Ga0099623_1000852); c00141_3300006.. (original name was: 3300006322.a:Ga0099623_1010085); c00142_3300006.. (original name was: 3300006322.a:Ga0099623_1000388); c00143_3300006.. (original name was: 3300006322.a:Ga0099623_1000657); c00144_3300006.. (original name was: 3300006322.a:Ga0099623_1003430); c00145_3300006.. (original name was: 3300006322.a:Ga0099623_1003477); c00146_3300006.. (original name was: 3300006322.a:Ga0099623_1000384); c00147_3300006.. (original name was: 3300006322.a:Ga0099623_1000562); c00148_3300006.. (original name was: 3300006322.a:Ga0099623_1003712); c00149_3300006.. (original name was: 3300006322.a:Ga0099623_1000041); c00150_3300006.. (original name was: 3300006322.a:Ga0099623_1002233); c00151_3300006.. (original name was: 3300006322.a:Ga0099623_1000232); c00152_3300006.. (original name was: 3300006322.a:Ga0099623_1000593); c00154_3300006.. (original name was: 3300006322.a:Ga0099623_1005712); c00155_3300006.. (original name was: 3300006322.a:Ga0099623_1000421); c00156_3300006.. (original name was: 3300006322.a:Ga0099623_1001296); c00157_3300006.. (original name was: 3300006322.a:Ga0099623_1002601); c00158_3300006.. (original name was: 3300006322.a:Ga0099623_1000252); c00159_3300006.. (original name was: 3300006322.a:Ga0099623_1003573); c00160_3300006.. (original name was: 3300006322.a:Ga0099623_1000984); c00161_3300006.. (original name was: 3300006322.a:Ga0099623_1001672); c00162_3300006.. (original name was: 3300006322.a:Ga0099623_1000552); c00163_3300006.. (original name was: 3300006322.a:Ga0099623_1007798); c00164_3300006.. (original name was: 3300006322.a:Ga0099623_1000118); c00165_3300006.. (original name was: 3300006322.a:Ga0099623_1000205); c00166_3300006.. (original name was: 3300006322.a:Ga0099623_1000040); c00167_3300006.. (original name was: 3300006322.a:Ga0099623_1004960); c00168_3300006.. (original name was: 3300006322.a:Ga0099623_1002036); c00169_3300006.. (original name was: 3300006322.a:Ga0099623_1004161); c00170_3300006.. (original name was: 3300006322.a:Ga0099623_1000183); c00171_3300006.. (original name was: 3300006322.a:Ga0099623_1000391)

Compact view

c00001_3300006.. - Region 1 - arylpolyene,ladderane

Download region GenBank file

Location: 1 - 11,370 nt. (total: 11,370 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00002_3300006.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 42,509 nt. (total: 42,509 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 42509:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (phe - asn) + (thr - D-asn) + (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_24

Search NORINE for peptide: strict or relaxed

AMP-binding (463..860): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAgVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (1515..1920): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLTeLGvVNK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

ctg2_25

Search NORINE for peptide: strict or relaxed

AMP-binding (470..873): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1527..1921): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKLGvVNK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg2_35

Search NORINE for peptide: strict or relaxed

AMP-binding (435..827): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00012_3300006.. - Region 1 - LAP

Download region GenBank file

Location: 2,443 - 23,926 nt. (total: 21,484 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00022_3300006.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 21,108 nt. (total: 21,108 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg22_7 - Putative Class II

ctg22_10 leader / core peptide: MKEENLELGQYLESDMLALSEEDVDGG - GDhbPDhaIILDhaAIDhbAYIDhaDhbNDhbCPDhbDhbACDhbRQC
ctg22_11 leader / core peptide: MQNTNDFQDVTWMQEVAEQEFDTDVFGA - CDhbDhbNDhbFDhaLDhaDHWGNKGGWCDhbIDhbKECMNWC
allorf_13667_13894 leader / core peptide: LGVMTPMCGCKIRSWRSTSRTNGSVNLLGG - RPDhbGDhaRPHRDhaMDhaLNGRCWNCDhaIRRNDhaDhaGRLDDhaDhbGDhaWNLLGKDhaMDhbA

Lanthipeptide(s) for ctg22_9 - Putative Class II

ctg22_10 leader / core peptide: MKEENLELGQYLESDMLALSEEDVDGG - GDhbPDhaIILDhaAIDhbAYIDhaDhbNDhbCPDhbDhbACDhbRQC
ctg22_11 leader / core peptide: MQNTNDFQDVTWMQEVAEQEFDTDVFGA - CDhbDhbNDhbFDhaLDhaDHWGNKGGWCDhbIDhbKECMNWC
allorf_13667_13894 leader / core peptide: LGVMTPMCGCKIRSWRSTSRTNGSVNLLGG - RPDhbGDhaRPHRDhaMDhaLNGRCWNCDhaIRRNDhaDhaGRLDDhaDhbGDhaWNLLGKDhaMDhbA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg22_10 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 2706.4 Da

Molecular weight: 2708.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2726.1 Da N = 1; 2744.1 Da N = 2; 2762.2 Da N = 3; 2780.2 Da N = 4; 2798.2 Da N = 5; 2816.2 Da N = 6; 2834.2 Da N = 7

ctg22_11 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 3196.4 Da

Molecular weight: 3198.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3216.6 Da N = 1; 3234.6 Da N = 2; 3252.6 Da N = 3

allorf_13667_13894 - Class II

Cleavage pHMM score: -3.30

RODEO score: 0

Monoisotopic mass: 4773.4 Da

Molecular weight: 4776.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4794.4 Da N = 1; 4812.4 Da N = 2; 4830.4 Da N = 3; 4848.4 Da N = 4; 4866.4 Da N = 5; 4884.5 Da N = 6; 4902.5 Da N = 7; 4920.5 Da N = 8; 4938.5 Da N = 9; 4956.5 Da N = 10

ctg22_10 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 2706.4 Da

Molecular weight: 2708.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2726.1 Da N = 1; 2744.1 Da N = 2; 2762.2 Da N = 3; 2780.2 Da N = 4; 2798.2 Da N = 5; 2816.2 Da N = 6; 2834.2 Da N = 7

ctg22_11 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 3196.4 Da

Molecular weight: 3198.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3216.6 Da N = 1; 3234.6 Da N = 2; 3252.6 Da N = 3

allorf_13667_13894 - Class II

Cleavage pHMM score: -3.30

RODEO score: 0

Monoisotopic mass: 4773.4 Da

Molecular weight: 4776.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4794.4 Da N = 1; 4812.4 Da N = 2; 4830.4 Da N = 3; 4848.4 Da N = 4; 4866.4 Da N = 5; 4884.5 Da N = 6; 4902.5 Da N = 7; 4920.5 Da N = 8; 4938.5 Da N = 9; 4956.5 Da N = 10

c00044_3300006.. - Region 1 - bacteriocin

Download region GenBank file

Location: 4,214 - 14,519 nt. (total: 10,306 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00068_3300006.. - Region 1 - LAP

Download region GenBank file

Location: 1 - 6,613 nt. (total: 6,613 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00106_3300006.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 11,982 nt. (total: 11,982 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00125_3300006.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 18,906 nt. (total: 18,906 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg125_10 - Putative Class II

allorf_00656_00787 leader / core peptide: LWSIACAVALAFA - CKAGADhaVGKADhaEPRGDGMDhaAPQLRGGDhaVAR
allorf_02282_02404 leader / core peptide: MTRFPEELRSSSGR - ALRGNDhbDhaRHAGLGLELCDhaIDhaRDhaGDhaRP
allorf_05862_06032 leader / core peptide: LFQSSDVGMLAVRRSCGEKSLLLGVSAAS - APDhaLLDhbDhbDhaGRCAGIPWWRCKPDhbLRCDhaD

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_00656_00787 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 2827.5 Da

Molecular weight: 2829.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2847.2 Da N = 1; 2865.2 Da N = 2; 2883.2 Da N = 3

allorf_02282_02404 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 2586.4 Da

Molecular weight: 2587.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2605.9 Da N = 1; 2623.9 Da N = 2; 2642.0 Da N = 3; 2660.0 Da N = 4; 2678.0 Da N = 5

allorf_05862_06032 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 2866.5 Da

Molecular weight: 2868.3 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2886.4 Da N = 1; 2904.4 Da N = 2; 2922.4 Da N = 3

c00125_3300006.. - Region 2 - LAP

Download region GenBank file

Location: 24,011 - 41,097 nt. (total: 17,087 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00139_3300006.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 41,144 nt. (total: 41,144 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 41144:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (X - X - pro - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg139_15

Search NORINE for peptide: strict or relaxed

AMP-binding (0..300): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKlfGtVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (957..1347): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFfVAlifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (1997..2374): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALllGAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg139_16

Search NORINE for peptide: strict or relaxed

AMP-binding (462..845): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DViEnstVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 50% (weak)

AMP-binding (1491..1877): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVlaL-LIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (2538..2913): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVilVtAIvK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (3587..3982): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAllmGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg139_17

Search NORINE for peptide: strict or relaxed

AMP-binding (522..908): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfpKVsngaK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 40% (weak)

c00153_3300006.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 38,822 nt. (total: 38,822 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38822:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg153_6

Search NORINE for peptide: strict or relaxed

AMP-binding (537..932): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNiSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

ctg153_13

Search NORINE for peptide: strict or relaxed

AMP-binding (450..838): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNlSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)