3300007348_3 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00003_3300007.. (original name was: 3300007348.a:Ga0104342_100118)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	lanthipeptide	1	13,810

c00007_3300007.. (original name was: 3300007348.a:Ga0104342_100032)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	lanthipeptide	48,500	71,430
Region 7.2	NRPS-like,T1PKS,LAP	79,011	145,119

c00014_3300007.. (original name was: 3300007348.a:Ga0104342_100011)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS	69,916	129,499

Region	Type	From	To	Similarity
Region 3.1	lanthipeptide	1	13,810
Region 7.1	lanthipeptide	48,500	71,430
Region 7.2	NRPS-like,T1PKS,LAP	79,011	145,119
Region 14.1	NRPS	69,916	129,499

No secondary metabolite regions were found in these records:: c00001_3300007.. (original name was: 3300007348.a:Ga0104342_105587); c00002_3300007.. (original name was: 3300007348.a:Ga0104342_102107); c00004_3300007.. (original name was: 3300007348.a:Ga0104342_100083); c00005_3300007.. (original name was: 3300007348.a:Ga0104342_100006); c00006_3300007.. (original name was: 3300007348.a:Ga0104342_100137); c00008_3300007.. (original name was: 3300007348.a:Ga0104342_100001); c00009_3300007.. (original name was: 3300007348.a:Ga0104342_100034); c00010_3300007.. (original name was: 3300007348.a:Ga0104342_100293); c00011_3300007.. (original name was: 3300007348.a:Ga0104342_100116); c00012_3300007.. (original name was: 3300007348.a:Ga0104342_100399); c00013_3300007.. (original name was: 3300007348.a:Ga0104342_100111); c00015_3300007.. (original name was: 3300007348.a:Ga0104342_100374); c00016_3300007.. (original name was: 3300007348.a:Ga0104342_100092); c00017_3300007.. (original name was: 3300007348.a:Ga0104342_101001); c00018_3300007.. (original name was: 3300007348.a:Ga0104342_100023); c00019_3300007.. (original name was: 3300007348.a:Ga0104342_100069); c00020_3300007.. (original name was: 3300007348.a:Ga0104342_100010); c00021_3300007.. (original name was: 3300007348.a:Ga0104342_100029); c00022_3300007.. (original name was: 3300007348.a:Ga0104342_100061); c00023_3300007.. (original name was: 3300007348.a:Ga0104342_100037); c00024_3300007.. (original name was: 3300007348.a:Ga0104342_104769); c00025_3300007.. (original name was: 3300007348.a:Ga0104342_100021); c00026_3300007.. (original name was: 3300007348.a:Ga0104342_100309)

Compact view

c00003_3300007.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 13,810 nt. (total: 13,810 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg3_4 - Putative Class II

ctg3_2 leader / core peptide: MEKKYNDEIIDNLAEMTDTEIEELLGA - GRGVVPDhbVDhbHECHMNDhaWQWFFGCC
allorf_00132_00299 leader / core peptide: VFLVSLEDFPATGCRFGYQGLSAFSCARLDGDVFWA - GERAVCRKADhaGKKVHPAHG
allorf_00376_00462 leader / core peptide: LCFLRAEVVTNLNTDLGS - CNDhaLNLPLGE
allorf_01005_01130 leader / core peptide: LGARFRICCESASPSACSIIMGKGIVGA - DCICVMAVDhaNERI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg3_2 - Class II: Cleavage pHMM score: 0.40; RODEO score: 0; Monoisotopic mass: 2726.2 Da; Molecular weight: 2728.1 Da; Number of bridges: 3
allorf_00132_00299 - Class II: Cleavage pHMM score: -7.00; RODEO score: 0; Monoisotopic mass: 1969.1 Da; Molecular weight: 1970.3 Da; Number of bridges: 1
allorf_00376_00462 - Class II: Cleavage pHMM score: -6.10; RODEO score: 0; Monoisotopic mass: 1040.5 Da; Molecular weight: 1041.2 Da; Number of bridges: 1
allorf_01005_01130 - Class II: Cleavage pHMM score: -4.60; RODEO score: 0; Monoisotopic mass: 1433.7 Da; Molecular weight: 1434.7 Da; Number of bridges: 1

c00007_3300007.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 48,500 - 71,430 nt. (total: 22,931 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg7_59 - Putative Class II

allorf_055616_055702 leader / core peptide: MFMLPRRALRLFAA - LYFDhbPKDPVNCEVDha
allorf_061913_062110 leader / core peptide: VWDVRRLAGCAGT - GVDhaGDhbDPQRDhaDhaCAHRDhaRGFWGRCWMKVDhaGRKLDhaDhbGGAGCQVHDDhaRRQDPRIP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_055616_055702 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 1574.8 Da

Molecular weight: 1575.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1593.8 Da N = 1

allorf_061913_062110 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 5547.8 Da

Molecular weight: 5551.2 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5569.2 Da N = 1; 5587.2 Da N = 2; 5605.2 Da N = 3; 5623.3 Da N = 4; 5641.3 Da N = 5; 5659.3 Da N = 6

c00007_3300007.. - Region 2 - LAP,NRPS-like,T1PKS

Download region GenBank file

Location: 79,011 - 145,119 nt. (total: 66,109 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00014_3300007.. - Region 1 - NRPS

Download region GenBank file

Location: 69,916 - 129,499 nt. (total: 59,584 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 69915 - 129499:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_81

Search NORINE for peptide: strict or relaxed

AMP-binding (23..236): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vAL-LGsggK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

ctg14_89

Search NORINE for peptide: strict or relaxed

AMP-binding (512..898): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DflKVASVaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

ctg14_90

Search NORINE for peptide: strict or relaxed

AMP-binding (300..687): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGciVaGiYK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (1344..1741): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlaLGkVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)