3300007525_2 - 7 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00005_3300007.. (original name was: 3300007525.a:Ga0105482_1000171)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	LAP	3,152	23,916

c00034_3300007.. (original name was: 3300007525.a:Ga0105482_1000045)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	NRPS	1	24,353

c00046_3300007.. (original name was: 3300007525.a:Ga0105482_1000137)

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	NRPS	1	25,904

c00079_3300007.. (original name was: 3300007525.a:Ga0105482_1000340)

Region	Type	From	To	Most similar known cluster		Similarity
Region 79.1	LAP	1	12,896

c00088_3300007.. (original name was: 3300007525.a:Ga0105482_1000004)

Region	Type	From	To	Most similar known cluster		Similarity
Region 88.1	T1PKS	34,254	115,680

c00094_3300007.. (original name was: 3300007525.a:Ga0105482_1000002)

Region	Type	From	To	Most similar known cluster		Similarity
Region 94.1	NRPS,T1PKS	71,728	145,619

c00110_3300007.. (original name was: 3300007525.a:Ga0105482_1000494)

Region	Type	From	To	Most similar known cluster		Similarity
Region 110.1	lanthipeptide	1	14,712

Region	Type	From	To	Similarity
Region 5.1	LAP	3,152	23,916
Region 34.1	NRPS	1	24,353
Region 46.1	NRPS	1	25,904
Region 79.1	LAP	1	12,896
Region 88.1	T1PKS	34,254	115,680
Region 94.1	NRPS,T1PKS	71,728	145,619
Region 110.1	lanthipeptide	1	14,712

No secondary metabolite regions were found in these records:: c00001_3300007.. (original name was: 3300007525.a:Ga0105482_1001677); c00002_3300007.. (original name was: 3300007525.a:Ga0105482_1004252); c00003_3300007.. (original name was: 3300007525.a:Ga0105482_1004667); c00004_3300007.. (original name was: 3300007525.a:Ga0105482_1003865); c00006_3300007.. (original name was: 3300007525.a:Ga0105482_1004557); c00007_3300007.. (original name was: 3300007525.a:Ga0105482_1003157); c00008_3300007.. (original name was: 3300007525.a:Ga0105482_1003142); c00009_3300007.. (original name was: 3300007525.a:Ga0105482_1000341); c00010_3300007.. (original name was: 3300007525.a:Ga0105482_1000041); c00011_3300007.. (original name was: 3300007525.a:Ga0105482_1000270); c00012_3300007.. (original name was: 3300007525.a:Ga0105482_1000017); c00013_3300007.. (original name was: 3300007525.a:Ga0105482_1000884); c00014_3300007.. (original name was: 3300007525.a:Ga0105482_1000272); c00015_3300007.. (original name was: 3300007525.a:Ga0105482_1000309); c00016_3300007.. (original name was: 3300007525.a:Ga0105482_1001052); c00017_3300007.. (original name was: 3300007525.a:Ga0105482_1000360); c00018_3300007.. (original name was: 3300007525.a:Ga0105482_1000468); c00019_3300007.. (original name was: 3300007525.a:Ga0105482_1000348); c00020_3300007.. (original name was: 3300007525.a:Ga0105482_1000037); c00021_3300007.. (original name was: 3300007525.a:Ga0105482_1000062); c00022_3300007.. (original name was: 3300007525.a:Ga0105482_1000031); c00023_3300007.. (original name was: 3300007525.a:Ga0105482_1001740); c00024_3300007.. (original name was: 3300007525.a:Ga0105482_1000328); c00025_3300007.. (original name was: 3300007525.a:Ga0105482_1000015); c00026_3300007.. (original name was: 3300007525.a:Ga0105482_1000093); c00027_3300007.. (original name was: 3300007525.a:Ga0105482_1000323); c00028_3300007.. (original name was: 3300007525.a:Ga0105482_1004826); c00029_3300007.. (original name was: 3300007525.a:Ga0105482_1001343); c00030_3300007.. (original name was: 3300007525.a:Ga0105482_1002874); c00031_3300007.. (original name was: 3300007525.a:Ga0105482_1003918); c00032_3300007.. (original name was: 3300007525.a:Ga0105482_1000149); c00033_3300007.. (original name was: 3300007525.a:Ga0105482_1000811); c00035_3300007.. (original name was: 3300007525.a:Ga0105482_1000414); c00036_3300007.. (original name was: 3300007525.a:Ga0105482_1000521); c00037_3300007.. (original name was: 3300007525.a:Ga0105482_1000598); c00038_3300007.. (original name was: 3300007525.a:Ga0105482_1004301); c00039_3300007.. (original name was: 3300007525.a:Ga0105482_1000005); c00040_3300007.. (original name was: 3300007525.a:Ga0105482_1000897); c00041_3300007.. (original name was: 3300007525.a:Ga0105482_1004593); c00042_3300007.. (original name was: 3300007525.a:Ga0105482_1001926); c00043_3300007.. (original name was: 3300007525.a:Ga0105482_1001826); c00044_3300007.. (original name was: 3300007525.a:Ga0105482_1001372); c00045_3300007.. (original name was: 3300007525.a:Ga0105482_1002772); c00047_3300007.. (original name was: 3300007525.a:Ga0105482_1000704); c00048_3300007.. (original name was: 3300007525.a:Ga0105482_1000649); c00049_3300007.. (original name was: 3300007525.a:Ga0105482_1000067); c00050_3300007.. (original name was: 3300007525.a:Ga0105482_1000960); c00051_3300007.. (original name was: 3300007525.a:Ga0105482_1000756); c00052_3300007.. (original name was: 3300007525.a:Ga0105482_1000001); c00053_3300007.. (original name was: 3300007525.a:Ga0105482_1000410); c00054_3300007.. (original name was: 3300007525.a:Ga0105482_1001048); c00055_3300007.. (original name was: 3300007525.a:Ga0105482_1000019); c00056_3300007.. (original name was: 3300007525.a:Ga0105482_1003917); c00057_3300007.. (original name was: 3300007525.a:Ga0105482_1001478); c00058_3300007.. (original name was: 3300007525.a:Ga0105482_1000744); c00059_3300007.. (original name was: 3300007525.a:Ga0105482_1000027); c00060_3300007.. (original name was: 3300007525.a:Ga0105482_1001170); c00061_3300007.. (original name was: 3300007525.a:Ga0105482_1000660); c00062_3300007.. (original name was: 3300007525.a:Ga0105482_1001378); c00063_3300007.. (original name was: 3300007525.a:Ga0105482_1000917); c00064_3300007.. (original name was: 3300007525.a:Ga0105482_1001932); c00065_3300007.. (original name was: 3300007525.a:Ga0105482_1000217); c00066_3300007.. (original name was: 3300007525.a:Ga0105482_1002395); c00067_3300007.. (original name was: 3300007525.a:Ga0105482_1000009); c00068_3300007.. (original name was: 3300007525.a:Ga0105482_1000006); c00069_3300007.. (original name was: 3300007525.a:Ga0105482_1001073); c00070_3300007.. (original name was: 3300007525.a:Ga0105482_1000073); c00071_3300007.. (original name was: 3300007525.a:Ga0105482_1000379); c00072_3300007.. (original name was: 3300007525.a:Ga0105482_1000518); c00073_3300007.. (original name was: 3300007525.a:Ga0105482_1000740); c00074_3300007.. (original name was: 3300007525.a:Ga0105482_1000264); c00075_3300007.. (original name was: 3300007525.a:Ga0105482_1003689); c00076_3300007.. (original name was: 3300007525.a:Ga0105482_1001097); c00077_3300007.. (original name was: 3300007525.a:Ga0105482_1000437); c00078_3300007.. (original name was: 3300007525.a:Ga0105482_1000174); c00080_3300007.. (original name was: 3300007525.a:Ga0105482_1000089); c00081_3300007.. (original name was: 3300007525.a:Ga0105482_1001525); c00082_3300007.. (original name was: 3300007525.a:Ga0105482_1000362); c00083_3300007.. (original name was: 3300007525.a:Ga0105482_1000023); c00084_3300007.. (original name was: 3300007525.a:Ga0105482_1001144); c00085_3300007.. (original name was: 3300007525.a:Ga0105482_1001707); c00086_3300007.. (original name was: 3300007525.a:Ga0105482_1000129); c00087_3300007.. (original name was: 3300007525.a:Ga0105482_1000201); c00089_3300007.. (original name was: 3300007525.a:Ga0105482_1000961); c00090_3300007.. (original name was: 3300007525.a:Ga0105482_1001546); c00091_3300007.. (original name was: 3300007525.a:Ga0105482_1003583); c00092_3300007.. (original name was: 3300007525.a:Ga0105482_1000248); c00093_3300007.. (original name was: 3300007525.a:Ga0105482_1000071); c00095_3300007.. (original name was: 3300007525.a:Ga0105482_1000102); c00096_3300007.. (original name was: 3300007525.a:Ga0105482_1000024); c00097_3300007.. (original name was: 3300007525.a:Ga0105482_1000285); c00098_3300007.. (original name was: 3300007525.a:Ga0105482_1000445); c00099_3300007.. (original name was: 3300007525.a:Ga0105482_1000227); c00100_3300007.. (original name was: 3300007525.a:Ga0105482_1000614); c00101_3300007.. (original name was: 3300007525.a:Ga0105482_1000133); c00102_3300007.. (original name was: 3300007525.a:Ga0105482_1000261); c00103_3300007.. (original name was: 3300007525.a:Ga0105482_1000082); c00104_3300007.. (original name was: 3300007525.a:Ga0105482_1000225); c00105_3300007.. (original name was: 3300007525.a:Ga0105482_1000087); c00106_3300007.. (original name was: 3300007525.a:Ga0105482_1000571); c00107_3300007.. (original name was: 3300007525.a:Ga0105482_1000054); c00108_3300007.. (original name was: 3300007525.a:Ga0105482_1000055); c00109_3300007.. (original name was: 3300007525.a:Ga0105482_1000283); c00111_3300007.. (original name was: 3300007525.a:Ga0105482_1000812); c00112_3300007.. (original name was: 3300007525.a:Ga0105482_1003423); c00113_3300007.. (original name was: 3300007525.a:Ga0105482_1000056); c00114_3300007.. (original name was: 3300007525.a:Ga0105482_1000469); c00115_3300007.. (original name was: 3300007525.a:Ga0105482_1000072); c00116_3300007.. (original name was: 3300007525.a:Ga0105482_1000169); c00117_3300007.. (original name was: 3300007525.a:Ga0105482_1003996); c00118_3300007.. (original name was: 3300007525.a:Ga0105482_1000114); c00119_3300007.. (original name was: 3300007525.a:Ga0105482_1000003); c00120_3300007.. (original name was: 3300007525.a:Ga0105482_1001801); c00121_3300007.. (original name was: 3300007525.a:Ga0105482_1000241); c00122_3300007.. (original name was: 3300007525.a:Ga0105482_1000008); c00123_3300007.. (original name was: 3300007525.a:Ga0105482_1001303); c00124_3300007.. (original name was: 3300007525.a:Ga0105482_1000022); c00125_3300007.. (original name was: 3300007525.a:Ga0105482_1000152); c00126_3300007.. (original name was: 3300007525.a:Ga0105482_1000035); c00127_3300007.. (original name was: 3300007525.a:Ga0105482_1004730); c00128_3300007.. (original name was: 3300007525.a:Ga0105482_1001302)

Compact view

c00005_3300007.. - Region 1 - LAP

Download region GenBank file

Location: 3,152 - 23,916 nt. (total: 20,765 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00034_3300007.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 24,353 nt. (total: 24,353 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24353:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_1

Search NORINE for peptide: strict or relaxed

AMP-binding (414..807): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWegGfVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

c00046_3300007.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 25,904 nt. (total: 25,904 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25904:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg46_4

Search NORINE for peptide: strict or relaxed

AMP-binding (29..243): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vAL-LGsggK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

ctg46_12

Search NORINE for peptide: strict or relaxed

AMP-binding (512..898): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DflKVASVaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

ctg46_13

Search NORINE for peptide: strict or relaxed

AMP-binding (1..364): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGciVaGiYK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (1021..1418): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlaLGkVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

c00079_3300007.. - Region 1 - LAP

Download region GenBank file

Location: 1 - 12,896 nt. (total: 12,896 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00088_3300007.. - Region 1 - T1PKS

Download region GenBank file

Location: 34,254 - 115,680 nt. (total: 81,427 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 34253 - 115680:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - ccmal) + (Me-ohmal) + (Me-ohmal) + (mal - pk - ohmal) + (Me-ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg88_38

Search NORINE for peptide: strict or relaxed

AMP-binding (20..431): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: hcwcTAvgpK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 30% (weak)

ctg88_52

PKS_AT (557..840): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.5
Ethylmalonyl-CoA: 164.9
Methoxymalonyl-CoA: 142.9
trans-1,2-CPDA: 110.9
2-Methylbutyryl-CoA: 95.2
Malonyl-CoA: 81.8
Propionyl-CoA: 78.5
CHC-CoA: 78.0
Benzoyl-CoA: 69.7
Isobutyryl-CoA: 69.5
Acetyl-CoA: 43.1
3-Methylbutyryl-CoA: 34.2
inactive: 32.3
fatty_acid: 25.7

PKS_AT (1994..2275): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 147.8
inactive: 84.4
Methoxymalonyl-CoA: 81.1
Methylmalonyl-CoA: 67.7
Isobutyryl-CoA: 46.2
Propionyl-CoA: 40.8
trans-1,2-CPDA: 37.5
Benzoyl-CoA: 37.3
Ethylmalonyl-CoA: 35.9
2-Methylbutyryl-CoA: 29.1
CHC-CoA: 27.8
Acetyl-CoA: 23.1
fatty_acid: 22.0
3-Methylbutyryl-CoA: 12.7

ctg88_53

PKS_AT (570..865): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.1
Ethylmalonyl-CoA: 138.1
Methoxymalonyl-CoA: 108.9
2-Methylbutyryl-CoA: 87.6
trans-1,2-CPDA: 79.0
Propionyl-CoA: 77.8
Malonyl-CoA: 71.8
Isobutyryl-CoA: 53.6
CHC-CoA: 50.7
Acetyl-CoA: 41.0
Benzoyl-CoA: 39.3
3-Methylbutyryl-CoA: 20.5
inactive: 18.9
fatty_acid: 6.0

ctg88_54

PKS_AT (547..841): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 189.3
Ethylmalonyl-CoA: 172.3
Methoxymalonyl-CoA: 155.9
2-Methylbutyryl-CoA: 98.6
Propionyl-CoA: 90.7
trans-1,2-CPDA: 89.0
CHC-CoA: 86.6
Malonyl-CoA: 85.0
Benzoyl-CoA: 57.0
Isobutyryl-CoA: 46.2
Acetyl-CoA: 43.3
fatty_acid: 23.8
3-Methylbutyryl-CoA: 16.8
inactive: 16.5

ctg88_55

PKS_AT (491..776): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 161.1
inactive: 88.0
Methoxymalonyl-CoA: 60.6
Methylmalonyl-CoA: 55.2
Isobutyryl-CoA: 26.8
Propionyl-CoA: 25.4
Ethylmalonyl-CoA: 23.4
Benzoyl-CoA: 20.7
Acetyl-CoA: 19.9
CHC-CoA: 15.1
2-Methylbutyryl-CoA: 11.1
trans-1,2-CPDA: 9.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1475..1771): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 142.1
Methoxymalonyl-CoA: 124.2
Ethylmalonyl-CoA: 123.9
Malonyl-CoA: 88.9
trans-1,2-CPDA: 79.1
Propionyl-CoA: 71.0
2-Methylbutyryl-CoA: 66.2
Isobutyryl-CoA: 53.3
CHC-CoA: 52.4
fatty_acid: 39.3
Benzoyl-CoA: 38.5
Acetyl-CoA: 36.1
inactive: 28.7
3-Methylbutyryl-CoA: 24.3

PKS_AT (3138..3412): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 141.7
inactive: 77.3
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 54.8
Benzoyl-CoA: 27.9
Acetyl-CoA: 26.8
Ethylmalonyl-CoA: 26.6
fatty_acid: 23.3
Isobutyryl-CoA: 22.4
2-Methylbutyryl-CoA: 21.0
trans-1,2-CPDA: 20.3
CHC-CoA: 19.4
Propionyl-CoA: 18.2
3-Methylbutyryl-CoA: 0.0

ctg88_58

PKS_AT (551..851): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 88.1
Methoxymalonyl-CoA: 65.9
Ethylmalonyl-CoA: 59.1
2-Methylbutyryl-CoA: 41.4
trans-1,2-CPDA: 36.8
Propionyl-CoA: 35.3
CHC-CoA: 32.3
Malonyl-CoA: 30.6
Isobutyryl-CoA: 29.4
fatty_acid: 12.9
Benzoyl-CoA: 11.2
Acetyl-CoA: 9.8
inactive: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2243..2511): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.1
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 56.6
Isobutyryl-CoA: 29.8
fatty_acid: 25.9
2-Methylbutyryl-CoA: 24.6
Ethylmalonyl-CoA: 22.9
Acetyl-CoA: 19.3
Benzoyl-CoA: 18.8
Propionyl-CoA: 18.5
CHC-CoA: 14.4
inactive: 13.2
3-Methylbutyryl-CoA: 13.1
trans-1,2-CPDA: 10.9

c00094_3300007.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 71,728 - 145,619 nt. (total: 73,892 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 71727 - 145619:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (ser) + (ccmal) + (gly - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg94_94

Search NORINE for peptide: strict or relaxed

AMP-binding (46..409): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: tAaALmGwgK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

ctg94_95

Search NORINE for peptide: strict or relaxed

AMP-binding (57..238): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vVlWaG---K
Nearest Stachelhaus code:: val
Stachelhaus code match:: 40% (weak)

ctg94_104

Search NORINE for peptide: strict or relaxed

AMP-binding (495..884): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1931..2318): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAaTgtAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg94_105

PKS_AT (519..809): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.1
inactive: 70.0
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 49.7
Propionyl-CoA: 44.5
2-Methylbutyryl-CoA: 27.2
Benzoyl-CoA: 23.8
Ethylmalonyl-CoA: 21.3
CHC-CoA: 21.3
Isobutyryl-CoA: 19.2
trans-1,2-CPDA: 11.5
Acetyl-CoA: 10.5
fatty_acid: 9.3
3-Methylbutyryl-CoA: 0.0

ctg94_106

Search NORINE for peptide: strict or relaxed

AMP-binding (491..890): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg94_107

PKS_AT (562..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 133.4
inactive: 83.4
Methylmalonyl-CoA: 71.5
Methoxymalonyl-CoA: 68.0
Ethylmalonyl-CoA: 41.2
Isobutyryl-CoA: 36.4
Propionyl-CoA: 35.6
2-Methylbutyryl-CoA: 32.0
Acetyl-CoA: 29.6
Benzoyl-CoA: 23.5
trans-1,2-CPDA: 23.4
fatty_acid: 22.8
CHC-CoA: 19.0
3-Methylbutyryl-CoA: 10.8

ctg94_110

PKS_AT (495..788): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 140.9
Methoxymalonyl-CoA: 111.2
Ethylmalonyl-CoA: 98.6
Malonyl-CoA: 66.1
trans-1,2-CPDA: 64.5
Propionyl-CoA: 59.5
Benzoyl-CoA: 55.8
Isobutyryl-CoA: 55.6
Acetyl-CoA: 50.5
2-Methylbutyryl-CoA: 48.7
CHC-CoA: 42.8
3-Methylbutyryl-CoA: 32.2
inactive: 19.5
fatty_acid: 15.4

c00110_3300007.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 14,712 nt. (total: 14,712 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg110_5 - Putative Class II

allorf_01598_01762 leader / core peptide: LMGNMLLIWYDGGRCVHSWFSCARMVSYA - DhbDhbCRPDVHNDhaFPRVDhaADGADhaLDhbDhaGI
allorf_02062_02286 leader / core peptide: MLYFGFSAGKSPSQRHFDLLLIYSFVSVVFQEILIFLMKCESCVMPCRELFLVPSGLFTKRIIGG - DLEKDhbCDhaIL
allorf_02328_02414 leader / core peptide: MFMLPRRALRLFAA - LYFDhbPKGPVNCEVDha
allorf_08624_08710 leader / core peptide: MKVSGRKLSTGG - AGCQVHDDhaRRQDPRIP
allorf_08723_08821 leader / core peptide: VWDVRRLVGCGGA - GVDhaGDhbDPQRDhaDhaCARRDhaCGF

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_01598_01762 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 2461.2 Da

Molecular weight: 2462.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2480.7 Da N = 1; 2498.7 Da N = 2; 2516.7 Da N = 3; 2534.7 Da N = 4; 2552.8 Da N = 5; 2570.8 Da N = 6

allorf_02062_02286 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 984.5 Da

Molecular weight: 985.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1003.2 Da N = 1

allorf_02328_02414 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 1516.8 Da

Molecular weight: 1517.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1535.8 Da N = 1

allorf_08624_08710 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 1815.9 Da

Molecular weight: 1817.0 Da

Number of bridges: 1

allorf_08723_08821 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 1879.9 Da

Molecular weight: 1881.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1899.1 Da N = 1; 1917.1 Da N = 2; 1935.1 Da N = 3