3300008089_8 - 6 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00003_3300008.. (original name was: 3300008089.a:Ga0104978_1002400)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	bacteriocin	1	7,968

c00036_3300008.. (original name was: 3300008089.a:Ga0104978_1000329)

Region	Type	From	To	Most similar known cluster		Similarity
Region 36.1	thiopeptide,LAP	1	19,027

c00042_3300008.. (original name was: 3300008089.a:Ga0104978_1000105)

Region	Type	From	To	Most similar known cluster		Similarity
Region 42.1	NRPS	1	44,362

c00101_3300008.. (original name was: 3300008089.a:Ga0104978_1000123)

Region	Type	From	To	Most similar known cluster		Similarity
Region 101.1	T1PKS,NRPS	1	46,093

c00133_3300008.. (original name was: 3300008089.a:Ga0104978_1000122)

Region	Type	From	To	Most similar known cluster		Similarity
Region 133.1	NRPS	1	48,705

c00179_3300008.. (original name was: 3300008089.a:Ga0104978_1001323)

Region	Type	From	To	Most similar known cluster		Similarity
Region 179.1	lanthipeptide	1	13,610

Region	Type	From	To	Similarity
Region 3.1	bacteriocin	1	7,968
Region 36.1	thiopeptide,LAP	1	19,027
Region 42.1	NRPS	1	44,362
Region 101.1	T1PKS,NRPS	1	46,093
Region 133.1	NRPS	1	48,705
Region 179.1	lanthipeptide	1	13,610

No secondary metabolite regions were found in these records:: c00001_3300008.. (original name was: 3300008089.a:Ga0104978_1002504); c00002_3300008.. (original name was: 3300008089.a:Ga0104978_1004041); c00004_3300008.. (original name was: 3300008089.a:Ga0104978_1009021); c00005_3300008.. (original name was: 3300008089.a:Ga0104978_1003497); c00006_3300008.. (original name was: 3300008089.a:Ga0104978_1001747); c00007_3300008.. (original name was: 3300008089.a:Ga0104978_1006376); c00008_3300008.. (original name was: 3300008089.a:Ga0104978_1008544); c00009_3300008.. (original name was: 3300008089.a:Ga0104978_1000483); c00010_3300008.. (original name was: 3300008089.a:Ga0104978_1003034); c00011_3300008.. (original name was: 3300008089.a:Ga0104978_1001115); c00012_3300008.. (original name was: 3300008089.a:Ga0104978_1007356); c00013_3300008.. (original name was: 3300008089.a:Ga0104978_1002428); c00014_3300008.. (original name was: 3300008089.a:Ga0104978_1001378); c00015_3300008.. (original name was: 3300008089.a:Ga0104978_1004640); c00016_3300008.. (original name was: 3300008089.a:Ga0104978_1001719); c00017_3300008.. (original name was: 3300008089.a:Ga0104978_1003772); c00018_3300008.. (original name was: 3300008089.a:Ga0104978_1000156); c00019_3300008.. (original name was: 3300008089.a:Ga0104978_1007078); c00020_3300008.. (original name was: 3300008089.a:Ga0104978_1002052); c00021_3300008.. (original name was: 3300008089.a:Ga0104978_1004438); c00022_3300008.. (original name was: 3300008089.a:Ga0104978_1000893); c00023_3300008.. (original name was: 3300008089.a:Ga0104978_1000237); c00024_3300008.. (original name was: 3300008089.a:Ga0104978_1001664); c00025_3300008.. (original name was: 3300008089.a:Ga0104978_1005737); c00026_3300008.. (original name was: 3300008089.a:Ga0104978_1000039); c00027_3300008.. (original name was: 3300008089.a:Ga0104978_1006472); c00028_3300008.. (original name was: 3300008089.a:Ga0104978_1000857); c00029_3300008.. (original name was: 3300008089.a:Ga0104978_1000085); c00030_3300008.. (original name was: 3300008089.a:Ga0104978_1001811); c00031_3300008.. (original name was: 3300008089.a:Ga0104978_1000183); c00032_3300008.. (original name was: 3300008089.a:Ga0104978_1001799); c00033_3300008.. (original name was: 3300008089.a:Ga0104978_1001429); c00034_3300008.. (original name was: 3300008089.a:Ga0104978_1003187); c00035_3300008.. (original name was: 3300008089.a:Ga0104978_1000543); c00037_3300008.. (original name was: 3300008089.a:Ga0104978_1000211); c00038_3300008.. (original name was: 3300008089.a:Ga0104978_1000219); c00039_3300008.. (original name was: 3300008089.a:Ga0104978_1005045); c00040_3300008.. (original name was: 3300008089.a:Ga0104978_1000295); c00041_3300008.. (original name was: 3300008089.a:Ga0104978_1000445); c00043_3300008.. (original name was: 3300008089.a:Ga0104978_1001289); c00044_3300008.. (original name was: 3300008089.a:Ga0104978_1000505); c00045_3300008.. (original name was: 3300008089.a:Ga0104978_1001669); c00046_3300008.. (original name was: 3300008089.a:Ga0104978_1007205); c00047_3300008.. (original name was: 3300008089.a:Ga0104978_1001898); c00048_3300008.. (original name was: 3300008089.a:Ga0104978_1000235); c00049_3300008.. (original name was: 3300008089.a:Ga0104978_1005959); c00050_3300008.. (original name was: 3300008089.a:Ga0104978_1000547); c00051_3300008.. (original name was: 3300008089.a:Ga0104978_1001096); c00052_3300008.. (original name was: 3300008089.a:Ga0104978_1000153); c00053_3300008.. (original name was: 3300008089.a:Ga0104978_1002495); c00054_3300008.. (original name was: 3300008089.a:Ga0104978_1006285); c00055_3300008.. (original name was: 3300008089.a:Ga0104978_1000969); c00056_3300008.. (original name was: 3300008089.a:Ga0104978_1005167); c00057_3300008.. (original name was: 3300008089.a:Ga0104978_1001008); c00058_3300008.. (original name was: 3300008089.a:Ga0104978_1002494); c00059_3300008.. (original name was: 3300008089.a:Ga0104978_1000312); c00060_3300008.. (original name was: 3300008089.a:Ga0104978_1001882); c00061_3300008.. (original name was: 3300008089.a:Ga0104978_1000470); c00062_3300008.. (original name was: 3300008089.a:Ga0104978_1002562); c00063_3300008.. (original name was: 3300008089.a:Ga0104978_1002049); c00064_3300008.. (original name was: 3300008089.a:Ga0104978_1002788); c00065_3300008.. (original name was: 3300008089.a:Ga0104978_1001749); c00066_3300008.. (original name was: 3300008089.a:Ga0104978_1001422); c00067_3300008.. (original name was: 3300008089.a:Ga0104978_1001384); c00068_3300008.. (original name was: 3300008089.a:Ga0104978_1000318); c00069_3300008.. (original name was: 3300008089.a:Ga0104978_1007069); c00070_3300008.. (original name was: 3300008089.a:Ga0104978_1000182); c00071_3300008.. (original name was: 3300008089.a:Ga0104978_1001920); c00072_3300008.. (original name was: 3300008089.a:Ga0104978_1004186); c00073_3300008.. (original name was: 3300008089.a:Ga0104978_1000246); c00074_3300008.. (original name was: 3300008089.a:Ga0104978_1002030); c00075_3300008.. (original name was: 3300008089.a:Ga0104978_1000914); c00076_3300008.. (original name was: 3300008089.a:Ga0104978_1002201); c00077_3300008.. (original name was: 3300008089.a:Ga0104978_1000302); c00078_3300008.. (original name was: 3300008089.a:Ga0104978_1000250); c00079_3300008.. (original name was: 3300008089.a:Ga0104978_1003724); c00080_3300008.. (original name was: 3300008089.a:Ga0104978_1002401); c00081_3300008.. (original name was: 3300008089.a:Ga0104978_1001083); c00082_3300008.. (original name was: 3300008089.a:Ga0104978_1005046); c00083_3300008.. (original name was: 3300008089.a:Ga0104978_1006149); c00084_3300008.. (original name was: 3300008089.a:Ga0104978_1005664); c00085_3300008.. (original name was: 3300008089.a:Ga0104978_1000340); c00086_3300008.. (original name was: 3300008089.a:Ga0104978_1005510); c00087_3300008.. (original name was: 3300008089.a:Ga0104978_1000309); c00088_3300008.. (original name was: 3300008089.a:Ga0104978_1001795); c00089_3300008.. (original name was: 3300008089.a:Ga0104978_1000023); c00090_3300008.. (original name was: 3300008089.a:Ga0104978_1000722); c00091_3300008.. (original name was: 3300008089.a:Ga0104978_1000477); c00092_3300008.. (original name was: 3300008089.a:Ga0104978_1001298); c00093_3300008.. (original name was: 3300008089.a:Ga0104978_1007942); c00094_3300008.. (original name was: 3300008089.a:Ga0104978_1001822); c00095_3300008.. (original name was: 3300008089.a:Ga0104978_1008121); c00096_3300008.. (original name was: 3300008089.a:Ga0104978_1002597); c00097_3300008.. (original name was: 3300008089.a:Ga0104978_1002712); c00098_3300008.. (original name was: 3300008089.a:Ga0104978_1000348); c00099_3300008.. (original name was: 3300008089.a:Ga0104978_1002535); c00100_3300008.. (original name was: 3300008089.a:Ga0104978_1006730); c00102_3300008.. (original name was: 3300008089.a:Ga0104978_1000615); c00103_3300008.. (original name was: 3300008089.a:Ga0104978_1006666); c00104_3300008.. (original name was: 3300008089.a:Ga0104978_1000430); c00105_3300008.. (original name was: 3300008089.a:Ga0104978_1002903); c00106_3300008.. (original name was: 3300008089.a:Ga0104978_1001151); c00107_3300008.. (original name was: 3300008089.a:Ga0104978_1000366); c00108_3300008.. (original name was: 3300008089.a:Ga0104978_1001987); c00109_3300008.. (original name was: 3300008089.a:Ga0104978_1000272); c00110_3300008.. (original name was: 3300008089.a:Ga0104978_1003754); c00111_3300008.. (original name was: 3300008089.a:Ga0104978_1006403); c00112_3300008.. (original name was: 3300008089.a:Ga0104978_1002310); c00113_3300008.. (original name was: 3300008089.a:Ga0104978_1005465); c00114_3300008.. (original name was: 3300008089.a:Ga0104978_1000279); c00115_3300008.. (original name was: 3300008089.a:Ga0104978_1001117); c00116_3300008.. (original name was: 3300008089.a:Ga0104978_1005434); c00117_3300008.. (original name was: 3300008089.a:Ga0104978_1001108); c00118_3300008.. (original name was: 3300008089.a:Ga0104978_1000101); c00119_3300008.. (original name was: 3300008089.a:Ga0104978_1005995); c00120_3300008.. (original name was: 3300008089.a:Ga0104978_1000060); c00121_3300008.. (original name was: 3300008089.a:Ga0104978_1001091); c00122_3300008.. (original name was: 3300008089.a:Ga0104978_1003899); c00123_3300008.. (original name was: 3300008089.a:Ga0104978_1001118); c00124_3300008.. (original name was: 3300008089.a:Ga0104978_1000090); c00125_3300008.. (original name was: 3300008089.a:Ga0104978_1003443); c00126_3300008.. (original name was: 3300008089.a:Ga0104978_1001460); c00127_3300008.. (original name was: 3300008089.a:Ga0104978_1001269); c00128_3300008.. (original name was: 3300008089.a:Ga0104978_1000191); c00129_3300008.. (original name was: 3300008089.a:Ga0104978_1000568); c00130_3300008.. (original name was: 3300008089.a:Ga0104978_1007210); c00131_3300008.. (original name was: 3300008089.a:Ga0104978_1003498); c00132_3300008.. (original name was: 3300008089.a:Ga0104978_1003770); c00134_3300008.. (original name was: 3300008089.a:Ga0104978_1000766); c00135_3300008.. (original name was: 3300008089.a:Ga0104978_1000428); c00136_3300008.. (original name was: 3300008089.a:Ga0104978_1000443); c00137_3300008.. (original name was: 3300008089.a:Ga0104978_1004682); c00138_3300008.. (original name was: 3300008089.a:Ga0104978_1005961); c00139_3300008.. (original name was: 3300008089.a:Ga0104978_1000176); c00140_3300008.. (original name was: 3300008089.a:Ga0104978_1004500); c00141_3300008.. (original name was: 3300008089.a:Ga0104978_1001875); c00142_3300008.. (original name was: 3300008089.a:Ga0104978_1001209); c00143_3300008.. (original name was: 3300008089.a:Ga0104978_1000433); c00144_3300008.. (original name was: 3300008089.a:Ga0104978_1001165); c00145_3300008.. (original name was: 3300008089.a:Ga0104978_1004870); c00146_3300008.. (original name was: 3300008089.a:Ga0104978_1003156); c00147_3300008.. (original name was: 3300008089.a:Ga0104978_1000166); c00148_3300008.. (original name was: 3300008089.a:Ga0104978_1003646); c00149_3300008.. (original name was: 3300008089.a:Ga0104978_1003543); c00150_3300008.. (original name was: 3300008089.a:Ga0104978_1000276); c00151_3300008.. (original name was: 3300008089.a:Ga0104978_1001473); c00152_3300008.. (original name was: 3300008089.a:Ga0104978_1004918); c00153_3300008.. (original name was: 3300008089.a:Ga0104978_1004255); c00154_3300008.. (original name was: 3300008089.a:Ga0104978_1004653); c00155_3300008.. (original name was: 3300008089.a:Ga0104978_1000320); c00156_3300008.. (original name was: 3300008089.a:Ga0104978_1000403); c00157_3300008.. (original name was: 3300008089.a:Ga0104978_1001475); c00158_3300008.. (original name was: 3300008089.a:Ga0104978_1003777); c00159_3300008.. (original name was: 3300008089.a:Ga0104978_1005357); c00160_3300008.. (original name was: 3300008089.a:Ga0104978_1004623); c00161_3300008.. (original name was: 3300008089.a:Ga0104978_1000891); c00162_3300008.. (original name was: 3300008089.a:Ga0104978_1000426); c00163_3300008.. (original name was: 3300008089.a:Ga0104978_1000854); c00164_3300008.. (original name was: 3300008089.a:Ga0104978_1003244); c00165_3300008.. (original name was: 3300008089.a:Ga0104978_1000275); c00166_3300008.. (original name was: 3300008089.a:Ga0104978_1006855); c00167_3300008.. (original name was: 3300008089.a:Ga0104978_1004344); c00168_3300008.. (original name was: 3300008089.a:Ga0104978_1006570); c00169_3300008.. (original name was: 3300008089.a:Ga0104978_1002287); c00170_3300008.. (original name was: 3300008089.a:Ga0104978_1002406); c00171_3300008.. (original name was: 3300008089.a:Ga0104978_1004771); c00172_3300008.. (original name was: 3300008089.a:Ga0104978_1001007); c00173_3300008.. (original name was: 3300008089.a:Ga0104978_1003440); c00174_3300008.. (original name was: 3300008089.a:Ga0104978_1001832); c00175_3300008.. (original name was: 3300008089.a:Ga0104978_1004141); c00176_3300008.. (original name was: 3300008089.a:Ga0104978_1004002); c00177_3300008.. (original name was: 3300008089.a:Ga0104978_1001980); c00178_3300008.. (original name was: 3300008089.a:Ga0104978_1003598); c00180_3300008.. (original name was: 3300008089.a:Ga0104978_1004435); c00181_3300008.. (original name was: 3300008089.a:Ga0104978_1003210); c00182_3300008.. (original name was: 3300008089.a:Ga0104978_1000579); c00183_3300008.. (original name was: 3300008089.a:Ga0104978_1004013); c00184_3300008.. (original name was: 3300008089.a:Ga0104978_1009042); c00185_3300008.. (original name was: 3300008089.a:Ga0104978_1002293); c00186_3300008.. (original name was: 3300008089.a:Ga0104978_1003821); c00187_3300008.. (original name was: 3300008089.a:Ga0104978_1003659); c00188_3300008.. (original name was: 3300008089.a:Ga0104978_1004291); c00189_3300008.. (original name was: 3300008089.a:Ga0104978_1005658)

Compact view

c00003_3300008.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 7,968 nt. (total: 7,968 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00036_3300008.. - Region 1 - LAP,thiopeptide

Download region GenBank file

Location: 1 - 19,027 nt. (total: 19,027 nt) Show pHMM detection rules used

Region on contig edge.

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)
LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Thiopeptides

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.

c00042_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 44,362 nt. (total: 44,362 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 44362:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg42_7

Search NORINE for peptide: strict or relaxed

AMP-binding (466..702): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLYN-----K
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 50% (weak)

ctg42_16

PKS_AT (23..266): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.9
Methylmalonyl-CoA: 46.7
Methoxymalonyl-CoA: 45.6
inactive: 36.2
Isobutyryl-CoA: 26.0
Ethylmalonyl-CoA: 19.7
fatty_acid: 19.6
Propionyl-CoA: 19.2
2-Methylbutyryl-CoA: 10.6
CHC-CoA: 10.3
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

ctg42_19

Search NORINE for peptide: strict or relaxed

AMP-binding (454..855): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVvHVSfVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00101_3300008.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 46,093 nt. (total: 46,093 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 46093:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg101_14

Search NORINE for peptide: strict or relaxed

AMP-binding (461..862): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DItnfGVmWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

PKS_AT (1568..1853): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 118.0
inactive: 54.7
Propionyl-CoA: 36.7
Methoxymalonyl-CoA: 34.2
Methylmalonyl-CoA: 31.0
Isobutyryl-CoA: 18.3
2-Methylbutyryl-CoA: 12.0
CHC-CoA: 11.0
Acetyl-CoA: 9.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 62.5%

AMP-binding (2468..2858): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiFqvGMVtK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (4317..4699): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpFLfGLivK
Nearest Stachelhaus code:: phg
Stachelhaus code match:: 60% (weak)

c00133_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 48,705 nt. (total: 48,705 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 48705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X - X - X - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg133_5

Search NORINE for peptide: strict or relaxed

AMP-binding (521..908): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfpKVsngaK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 40% (weak)

ctg133_6

Search NORINE for peptide: strict or relaxed

AMP-binding (462..845): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DViEnstVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 50% (weak)

AMP-binding (1491..1877): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVlvL-LIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (2538..2914): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVMlvTAiVK
Nearest Stachelhaus code:: trp, tyr
Stachelhaus code match:: 70% (weak)

AMP-binding (3589..3983): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAsimaLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

ctg133_7

Search NORINE for peptide: strict or relaxed

AMP-binding (824..1214): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFfVAlifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (1865..2241): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALllGAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

c00179_3300008.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 13,610 nt. (total: 13,610 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg179_5 - Putative Class II

ctg179_6 leader / core peptide: MNDILDQEITVVSPSWDTAARATDGSSPSLQAQIDAEFEQIVSPYM - LDhaDhaGWICDhbLDhbIECGDhbFICACR
allorf_12289_12465 leader / core peptide: MISTAALVVTHPRRSYRSIRYHITHNNDMEAYS - RADhbPRPEKPLARQCLRDhbAMNKPHGDha
allorf_12031_12147 leader / core peptide: VVRAEESLLG - IEENRAEVWDhaIIQVFYCHPQKFMALLLI
allorf_12265_12363 leader / core peptide: MGNMVSNAS - VGDhbAGMCYDQCCDhaRYHDhaDhbPLARK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg179_6 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 2186.0 Da

Molecular weight: 2187.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2205.6 Da N = 1

allorf_12289_12465 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 2760.5 Da

Molecular weight: 2762.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2780.2 Da N = 1; 2798.3 Da N = 2

allorf_12031_12147 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 3371.8 Da

Molecular weight: 3374.0 Da

Number of bridges: 1

allorf_12265_12363 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 2474.1 Da

Molecular weight: 2475.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2493.9 Da N = 1