3300008682_3 - 11 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00015_3300008.. (original name was: 3300008682.a:Ga0111556_1001769)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	bacteriocin	1	5,851

c00020_3300008.. (original name was: 3300008682.a:Ga0111556_1006780)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	NRPS	1	3,843

c00022_3300008.. (original name was: 3300008682.a:Ga0111556_1005224)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	1	4,752

c00041_3300008.. (original name was: 3300008682.a:Ga0111556_1000954)

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	NRPS	1	17,002

c00043_3300008.. (original name was: 3300008682.a:Ga0111556_1001289)

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	lanthipeptide	781	13,946

c00052_3300008.. (original name was: 3300008682.a:Ga0111556_1001798)

Region	Type	From	To	Most similar known cluster		Similarity
Region 52.1	lanthipeptide	1	11,052

c00068_3300008.. (original name was: 3300008682.a:Ga0111556_1000060)

Region	Type	From	To	Most similar known cluster		Similarity
Region 68.1	NRPS-like	11,944	53,908

c00069_3300008.. (original name was: 3300008682.a:Ga0111556_1000276)

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	lanthipeptide	1,241	29,137

c00078_3300008.. (original name was: 3300008682.a:Ga0111556_1000380)

Region	Type	From	To	Most similar known cluster		Similarity
Region 78.1	NRPS	1	29,173

c00093_3300008.. (original name was: 3300008682.a:Ga0111556_1000411)

Region	Type	From	To	Most similar known cluster		Similarity
Region 93.1	NRPS	1	29,029

c00122_3300008.. (original name was: 3300008682.a:Ga0111556_1000252)

Region	Type	From	To	Most similar known cluster		Similarity
Region 122.1	LAP	11,325	33,290

Region	Type	From	To	Similarity
Region 15.1	bacteriocin	1	5,851
Region 20.1	NRPS	1	3,843
Region 22.1	NRPS	1	4,752
Region 41.1	NRPS	1	17,002
Region 43.1	lanthipeptide	781	13,946
Region 52.1	lanthipeptide	1	11,052
Region 68.1	NRPS-like	11,944	53,908
Region 69.1	lanthipeptide	1,241	29,137
Region 78.1	NRPS	1	29,173
Region 93.1	NRPS	1	29,029
Region 122.1	LAP	11,325	33,290

No secondary metabolite regions were found in these records:: c00001_3300008.. (original name was: 3300008682.a:Ga0111556_1000497); c00002_3300008.. (original name was: 3300008682.a:Ga0111556_1006469); c00003_3300008.. (original name was: 3300008682.a:Ga0111556_1003404); c00004_3300008.. (original name was: 3300008682.a:Ga0111556_1006078); c00005_3300008.. (original name was: 3300008682.a:Ga0111556_1009035); c00006_3300008.. (original name was: 3300008682.a:Ga0111556_1003462); c00007_3300008.. (original name was: 3300008682.a:Ga0111556_1008205); c00008_3300008.. (original name was: 3300008682.a:Ga0111556_1008881); c00009_3300008.. (original name was: 3300008682.a:Ga0111556_1005500); c00010_3300008.. (original name was: 3300008682.a:Ga0111556_1004186); c00011_3300008.. (original name was: 3300008682.a:Ga0111556_1008576); c00012_3300008.. (original name was: 3300008682.a:Ga0111556_1008442); c00013_3300008.. (original name was: 3300008682.a:Ga0111556_1007775); c00014_3300008.. (original name was: 3300008682.a:Ga0111556_1008737); c00016_3300008.. (original name was: 3300008682.a:Ga0111556_1006060); c00017_3300008.. (original name was: 3300008682.a:Ga0111556_1002540); c00018_3300008.. (original name was: 3300008682.a:Ga0111556_1003460); c00019_3300008.. (original name was: 3300008682.a:Ga0111556_1003396); c00021_3300008.. (original name was: 3300008682.a:Ga0111556_1006757); c00023_3300008.. (original name was: 3300008682.a:Ga0111556_1008998); c00024_3300008.. (original name was: 3300008682.a:Ga0111556_1008157); c00025_3300008.. (original name was: 3300008682.a:Ga0111556_1004733); c00026_3300008.. (original name was: 3300008682.a:Ga0111556_1000139); c00027_3300008.. (original name was: 3300008682.a:Ga0111556_1000689); c00028_3300008.. (original name was: 3300008682.a:Ga0111556_1000381); c00029_3300008.. (original name was: 3300008682.a:Ga0111556_1002931); c00030_3300008.. (original name was: 3300008682.a:Ga0111556_1000345); c00031_3300008.. (original name was: 3300008682.a:Ga0111556_1007719); c00032_3300008.. (original name was: 3300008682.a:Ga0111556_1000685); c00033_3300008.. (original name was: 3300008682.a:Ga0111556_1000852); c00034_3300008.. (original name was: 3300008682.a:Ga0111556_1000094); c00035_3300008.. (original name was: 3300008682.a:Ga0111556_1004260); c00036_3300008.. (original name was: 3300008682.a:Ga0111556_1004099); c00037_3300008.. (original name was: 3300008682.a:Ga0111556_1000053); c00038_3300008.. (original name was: 3300008682.a:Ga0111556_1000339); c00039_3300008.. (original name was: 3300008682.a:Ga0111556_1004924); c00040_3300008.. (original name was: 3300008682.a:Ga0111556_1000047); c00042_3300008.. (original name was: 3300008682.a:Ga0111556_1000648); c00044_3300008.. (original name was: 3300008682.a:Ga0111556_1000122); c00045_3300008.. (original name was: 3300008682.a:Ga0111556_1002227); c00046_3300008.. (original name was: 3300008682.a:Ga0111556_1002460); c00047_3300008.. (original name was: 3300008682.a:Ga0111556_1000443); c00048_3300008.. (original name was: 3300008682.a:Ga0111556_1001235); c00049_3300008.. (original name was: 3300008682.a:Ga0111556_1002060); c00050_3300008.. (original name was: 3300008682.a:Ga0111556_1001169); c00051_3300008.. (original name was: 3300008682.a:Ga0111556_1000933); c00053_3300008.. (original name was: 3300008682.a:Ga0111556_1001860); c00054_3300008.. (original name was: 3300008682.a:Ga0111556_1006558); c00055_3300008.. (original name was: 3300008682.a:Ga0111556_1000167); c00056_3300008.. (original name was: 3300008682.a:Ga0111556_1000965); c00057_3300008.. (original name was: 3300008682.a:Ga0111556_1000105); c00058_3300008.. (original name was: 3300008682.a:Ga0111556_1003752); c00059_3300008.. (original name was: 3300008682.a:Ga0111556_1000250); c00060_3300008.. (original name was: 3300008682.a:Ga0111556_1000151); c00061_3300008.. (original name was: 3300008682.a:Ga0111556_1006006); c00062_3300008.. (original name was: 3300008682.a:Ga0111556_1001411); c00063_3300008.. (original name was: 3300008682.a:Ga0111556_1008483); c00064_3300008.. (original name was: 3300008682.a:Ga0111556_1000741); c00065_3300008.. (original name was: 3300008682.a:Ga0111556_1004295); c00066_3300008.. (original name was: 3300008682.a:Ga0111556_1001521); c00067_3300008.. (original name was: 3300008682.a:Ga0111556_1006427); c00070_3300008.. (original name was: 3300008682.a:Ga0111556_1001353); c00071_3300008.. (original name was: 3300008682.a:Ga0111556_1000265); c00072_3300008.. (original name was: 3300008682.a:Ga0111556_1000124); c00073_3300008.. (original name was: 3300008682.a:Ga0111556_1007358); c00074_3300008.. (original name was: 3300008682.a:Ga0111556_1001936); c00075_3300008.. (original name was: 3300008682.a:Ga0111556_1001847); c00076_3300008.. (original name was: 3300008682.a:Ga0111556_1000296); c00077_3300008.. (original name was: 3300008682.a:Ga0111556_1007515); c00079_3300008.. (original name was: 3300008682.a:Ga0111556_1000418); c00080_3300008.. (original name was: 3300008682.a:Ga0111556_1001472); c00081_3300008.. (original name was: 3300008682.a:Ga0111556_1000369); c00082_3300008.. (original name was: 3300008682.a:Ga0111556_1000198); c00083_3300008.. (original name was: 3300008682.a:Ga0111556_1000242); c00084_3300008.. (original name was: 3300008682.a:Ga0111556_1002742); c00085_3300008.. (original name was: 3300008682.a:Ga0111556_1001096); c00086_3300008.. (original name was: 3300008682.a:Ga0111556_1003516); c00087_3300008.. (original name was: 3300008682.a:Ga0111556_1000861); c00088_3300008.. (original name was: 3300008682.a:Ga0111556_1000324); c00089_3300008.. (original name was: 3300008682.a:Ga0111556_1002301); c00090_3300008.. (original name was: 3300008682.a:Ga0111556_1000048); c00091_3300008.. (original name was: 3300008682.a:Ga0111556_1005602); c00092_3300008.. (original name was: 3300008682.a:Ga0111556_1002134); c00094_3300008.. (original name was: 3300008682.a:Ga0111556_1000618); c00095_3300008.. (original name was: 3300008682.a:Ga0111556_1000206); c00096_3300008.. (original name was: 3300008682.a:Ga0111556_1007649); c00097_3300008.. (original name was: 3300008682.a:Ga0111556_1000301); c00098_3300008.. (original name was: 3300008682.a:Ga0111556_1000762); c00099_3300008.. (original name was: 3300008682.a:Ga0111556_1002389); c00100_3300008.. (original name was: 3300008682.a:Ga0111556_1007754); c00101_3300008.. (original name was: 3300008682.a:Ga0111556_1000085); c00102_3300008.. (original name was: 3300008682.a:Ga0111556_1002265); c00103_3300008.. (original name was: 3300008682.a:Ga0111556_1000096); c00104_3300008.. (original name was: 3300008682.a:Ga0111556_1004894); c00105_3300008.. (original name was: 3300008682.a:Ga0111556_1000022); c00106_3300008.. (original name was: 3300008682.a:Ga0111556_1002013); c00107_3300008.. (original name was: 3300008682.a:Ga0111556_1001738); c00108_3300008.. (original name was: 3300008682.a:Ga0111556_1008110); c00109_3300008.. (original name was: 3300008682.a:Ga0111556_1008370); c00110_3300008.. (original name was: 3300008682.a:Ga0111556_1000311); c00111_3300008.. (original name was: 3300008682.a:Ga0111556_1000229); c00112_3300008.. (original name was: 3300008682.a:Ga0111556_1000117); c00113_3300008.. (original name was: 3300008682.a:Ga0111556_1006926); c00114_3300008.. (original name was: 3300008682.a:Ga0111556_1000104); c00115_3300008.. (original name was: 3300008682.a:Ga0111556_1000675); c00116_3300008.. (original name was: 3300008682.a:Ga0111556_1000490); c00117_3300008.. (original name was: 3300008682.a:Ga0111556_1000255); c00118_3300008.. (original name was: 3300008682.a:Ga0111556_1001845); c00119_3300008.. (original name was: 3300008682.a:Ga0111556_1001698); c00120_3300008.. (original name was: 3300008682.a:Ga0111556_1000384); c00121_3300008.. (original name was: 3300008682.a:Ga0111556_1000069); c00123_3300008.. (original name was: 3300008682.a:Ga0111556_1001245); c00124_3300008.. (original name was: 3300008682.a:Ga0111556_1004520); c00125_3300008.. (original name was: 3300008682.a:Ga0111556_1001231); c00126_3300008.. (original name was: 3300008682.a:Ga0111556_1002880); c00127_3300008.. (original name was: 3300008682.a:Ga0111556_1004144); c00128_3300008.. (original name was: 3300008682.a:Ga0111556_1003323); c00129_3300008.. (original name was: 3300008682.a:Ga0111556_1000325); c00130_3300008.. (original name was: 3300008682.a:Ga0111556_1000010); c00131_3300008.. (original name was: 3300008682.a:Ga0111556_1000297); c00132_3300008.. (original name was: 3300008682.a:Ga0111556_1000488); c00133_3300008.. (original name was: 3300008682.a:Ga0111556_1000596); c00134_3300008.. (original name was: 3300008682.a:Ga0111556_1001812); c00135_3300008.. (original name was: 3300008682.a:Ga0111556_1001224); c00136_3300008.. (original name was: 3300008682.a:Ga0111556_1000902); c00137_3300008.. (original name was: 3300008682.a:Ga0111556_1000687); c00138_3300008.. (original name was: 3300008682.a:Ga0111556_1001664); c00139_3300008.. (original name was: 3300008682.a:Ga0111556_1000467); c00140_3300008.. (original name was: 3300008682.a:Ga0111556_1002299); c00141_3300008.. (original name was: 3300008682.a:Ga0111556_1000209); c00142_3300008.. (original name was: 3300008682.a:Ga0111556_1000583); c00143_3300008.. (original name was: 3300008682.a:Ga0111556_1000894); c00144_3300008.. (original name was: 3300008682.a:Ga0111556_1000025); c00145_3300008.. (original name was: 3300008682.a:Ga0111556_1000728); c00146_3300008.. (original name was: 3300008682.a:Ga0111556_1002361)

Compact view

c00015_3300008.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 5,851 nt. (total: 5,851 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00020_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,843 nt. (total: 3,843 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3843:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_1

Search NORINE for peptide: strict or relaxed

AMP-binding (476..866): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiFqvGMVtK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

c00022_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,752 nt. (total: 4,752 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00041_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 17,002 nt. (total: 17,002 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17002:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg41_1

Search NORINE for peptide: strict or relaxed

AMP-binding (462..845): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DViEnstVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 50% (weak)

AMP-binding (1491..1877): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgSilAAIdK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 60% (weak)

AMP-binding (2538..2914): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmLvGAIaK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg41_2

Search NORINE for peptide: strict or relaxed

AMP-binding (3..371): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKlfGtVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (1028..1420): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFfVAlifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (2067..2447): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALllGAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

c00043_3300008.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 781 - 13,946 nt. (total: 13,166 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg43_12 - Putative Class II

ctg43_10 leader / core peptide: MIKRLLVMAAG - DhbLVCMDhaVLFDhbDhaADhbPARADhaEEPVGYDVADhbDhaADhbGAEPDhaQFCFIAGFCG
allorf_03481_03600 leader / core peptide: LGSTAQLHHPARRATALFGG - NEDhbDhaRRDCANRGADhaCRCAG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg43_10 - Class II

Cleavage pHMM score: -2.60

RODEO score: 0

Monoisotopic mass: 4508.2 Da

Molecular weight: 4511.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4529.1 Da N = 1; 4547.1 Da N = 2; 4565.1 Da N = 3; 4583.1 Da N = 4; 4601.2 Da N = 5; 4619.2 Da N = 6; 4637.2 Da N = 7

allorf_03481_03600 - Class II

Cleavage pHMM score: -2.30

RODEO score: 0

Monoisotopic mass: 1971.9 Da

Molecular weight: 1973.1 Da

Number of bridges: 3

c00052_3300008.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 11,052 nt. (total: 11,052 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg52_3 - Putative Class II

ctg52_1 leader / core peptide: MTENRKNDLFSADVPLASELTEAGIDQTAGG - NDhaVADhaFDhaRRIGNRGRYCDhbLDhbQECQRICR
ctg52_2 leader / core peptide: MTQNNKQDFAAGYSHADLKALNDTTAAAG - DhbDhaDhbDhbACIRDhbIDhbIDhaWRICPDhbDhbAIDhbRAC

Lanthipeptide(s) for ctg52_5 - Putative Class II

ctg52_1 leader / core peptide: MTENRKNDLFSADVPLASELTEAGIDQTAGG - NDhaVADhaFDhaRRIGNRGRYCDhbLDhbQECQRICR
ctg52_2 leader / core peptide: MTQNNKQDFAAGYSHADLKALNDTTAAAG - DhbDhaDhbDhbACIRDhbIDhbIDhaWRICPDhbDhbAIDhbRAC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg52_1 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 3183.6 Da

Molecular weight: 3185.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3203.6 Da N = 1; 3221.6 Da N = 2

ctg52_2 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2659.5 Da

Molecular weight: 2661.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2679.2 Da N = 1; 2697.2 Da N = 2; 2715.2 Da N = 3; 2733.2 Da N = 4; 2751.2 Da N = 5; 2769.3 Da N = 6; 2787.3 Da N = 7

ctg52_1 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 3183.6 Da

Molecular weight: 3185.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3203.6 Da N = 1; 3221.6 Da N = 2

ctg52_2 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2659.5 Da

Molecular weight: 2661.1 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2679.2 Da N = 1; 2697.2 Da N = 2; 2715.2 Da N = 3; 2733.2 Da N = 4; 2751.2 Da N = 5; 2769.3 Da N = 6; 2787.3 Da N = 7

c00068_3300008.. - Region 1 - NRPS-like

Download region GenBank file

Location: 11,944 - 53,908 nt. (total: 41,965 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00069_3300008.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1,241 - 29,137 nt. (total: 27,897 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg69_16 - Putative Class II

ctg69_14 leader / core peptide: MQNTNDFQDVTWMQEVAEQEFDTDVFGA - CDhbDhbNDhbFDhaLDhaDHWGNKGGWCDhbIDhbKECMNWC
ctg69_15 leader / core peptide: MKEENLELGQYLESDMISLSEEDVDGG - GDhbPVILDhaIVDhbAYIDhaDhaNDhbCPDhbDhbACDhbRQC

Lanthipeptide(s) for ctg69_18 - Putative Class II

ctg69_14 leader / core peptide: MQNTNDFQDVTWMQEVAEQEFDTDVFGA - CDhbDhbNDhbFDhaLDhaDHWGNKGGWCDhbIDhbKECMNWC
ctg69_15 leader / core peptide: MKEENLELGQYLESDMISLSEEDVDGG - GDhbPVILDhaIVDhbAYIDhaDhaNDhbCPDhbDhbACDhbRQC
allorf_06797_07033 leader / core peptide: VNRRRVQPWKFYLEIGTPHPLNTLPSGQNPLSDLPPGVSTTRDTAPGA - DhaRAREAFAGIVRDhbEHPIRCAADhaGHHLRNRDhb
allorf_06829_06978 leader / core peptide: VRTIPANASRALDAPGA - VDhaRVVLDhbPGGRDhaEDhaGFWPDGRVFRGCGVPIDhaR
allorf_06857_07066 leader / core peptide: VLLRSTGRTPMLGPVPEMMSGCGTSDRVLGA - HDPGKRLDhbGDhaGRPRGCIPDhaRAHPWRKVREWILAGWQGV
allorf_08656_08772 leader / core peptide: VAVPWKPSLLDAAPGS - GHLRVKAVDhaREDhbIGCNDDhaNVWV
allorf_10517_10663 leader / core peptide: LVGLTLPMESHARRCSTGKLGCINFG - GCRQCNDhaCMDhbCHNDWKCLLNWE

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg69_14 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 3196.4 Da

Molecular weight: 3198.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3216.6 Da N = 1; 3234.6 Da N = 2; 3252.6 Da N = 3

ctg69_15 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 2637.4 Da

Molecular weight: 2639.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2657.1 Da N = 1; 2675.1 Da N = 2; 2693.1 Da N = 3; 2711.1 Da N = 4; 2729.1 Da N = 5; 2747.2 Da N = 6

allorf_06797_07033 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 3296.8 Da

Molecular weight: 3298.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3316.7 Da N = 1; 3334.7 Da N = 2; 3352.7 Da N = 3

allorf_06829_06978 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 3339.8 Da

Molecular weight: 3341.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3359.8 Da N = 1; 3377.8 Da N = 2; 3395.8 Da N = 3; 3413.9 Da N = 4

allorf_06857_07066 - Class II

Cleavage pHMM score: -3.60

RODEO score: 0

Monoisotopic mass: 4262.3 Da

Molecular weight: 4264.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4282.9 Da N = 1; 4300.9 Da N = 2

allorf_08656_08772 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 2385.2 Da

Molecular weight: 2386.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2404.7 Da N = 1; 2422.7 Da N = 2

allorf_10517_10663 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 2607.0 Da

Molecular weight: 2609.0 Da

Number of bridges: 2

ctg69_14 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 3196.4 Da

Molecular weight: 3198.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3216.6 Da N = 1; 3234.6 Da N = 2; 3252.6 Da N = 3

ctg69_15 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 2637.4 Da

Molecular weight: 2639.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2657.1 Da N = 1; 2675.1 Da N = 2; 2693.1 Da N = 3; 2711.1 Da N = 4; 2729.1 Da N = 5; 2747.2 Da N = 6

c00078_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 29,173 nt. (total: 29,173 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29173:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg78_1

Search NORINE for peptide: strict or relaxed

AMP-binding (607..1002): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAsimaLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

ctg78_2

Search NORINE for peptide: strict or relaxed

AMP-binding (523..908): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfpKVsngaK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 40% (weak)

c00093_3300008.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 29,029 nt. (total: 29,029 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 29029:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg93_10

Search NORINE for peptide: strict or relaxed

AMP-binding (21..416): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: egaFVAamLK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

ctg93_12

Search NORINE for peptide: strict or relaxed

AMP-binding (509..889): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

ctg93_13

Search NORINE for peptide: strict or relaxed

AMP-binding (553..948): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSgIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (1597..1981): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLfNiSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

c00122_3300008.. - Region 1 - LAP

Download region GenBank file

Location: 11,325 - 33,290 nt. (total: 21,966 nt) Show pHMM detection rules used

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it