3300009363_5 - 13 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00007_3300009.. (original name was: 3300009363.a:Ga0115223_1000324)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	1	37,343

c00015_3300009.. (original name was: 3300009363.a:Ga0115223_1003418)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	lanthipeptide	1	8,003

c00016_3300009.. (original name was: 3300009363.a:Ga0115223_1001775)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	LAP	1	13,570

c00071_3300009.. (original name was: 3300009363.a:Ga0115223_1000988)

Region	Type	From	To	Most similar known cluster		Similarity
Region 71.1	lanthipeptide	1	18,718

c00074_3300009.. (original name was: 3300009363.a:Ga0115223_1001875)

Region	Type	From	To	Most similar known cluster		Similarity
Region 74.1	bacteriocin	4,253	13,080

c00107_3300009.. (original name was: 3300009363.a:Ga0115223_1000113)

Region	Type	From	To	Most similar known cluster		Similarity
Region 107.1	NRPS	8,654	63,470

c00118_3300009.. (original name was: 3300009363.a:Ga0115223_1002525)

Region	Type	From	To	Most similar known cluster		Similarity
Region 118.1	LAP	1	10,317

c00137_3300009.. (original name was: 3300009363.a:Ga0115223_1000401)

Region	Type	From	To	Most similar known cluster		Similarity
Region 137.1	NRPS,T1PKS,transAT-PKS	1	34,127

c00150_3300009.. (original name was: 3300009363.a:Ga0115223_1000649)

Region	Type	From	To	Most similar known cluster		Similarity
Region 150.1	LAP	8,572	25,962

c00182_3300009.. (original name was: 3300009363.a:Ga0115223_1001835)

Region	Type	From	To	Most similar known cluster		Similarity
Region 182.1	NRPS	1	13,272

c00185_3300009.. (original name was: 3300009363.a:Ga0115223_1000513)

Region	Type	From	To	Most similar known cluster		Similarity
Region 185.1	lanthipeptide	4,159	26,456

c00216_3300009.. (original name was: 3300009363.a:Ga0115223_1000268)

Region	Type	From	To	Most similar known cluster		Similarity
Region 216.1	T1PKS,NRPS	1	27,496

c00221_3300009.. (original name was: 3300009363.a:Ga0115223_1000319)

Region	Type	From	To	Most similar known cluster		Similarity
Region 221.1	NRPS,T1PKS	1	37,672

Region	Type	From	To	Similarity
Region 7.1	NRPS	1	37,343
Region 15.1	lanthipeptide	1	8,003
Region 16.1	LAP	1	13,570
Region 71.1	lanthipeptide	1	18,718
Region 74.1	bacteriocin	4,253	13,080
Region 107.1	NRPS	8,654	63,470
Region 118.1	LAP	1	10,317
Region 137.1	NRPS,T1PKS,transAT-PKS	1	34,127
Region 150.1	LAP	8,572	25,962
Region 182.1	NRPS	1	13,272
Region 185.1	lanthipeptide	4,159	26,456
Region 216.1	T1PKS,NRPS	1	27,496
Region 221.1	NRPS,T1PKS	1	37,672

No secondary metabolite regions were found in these records:: c00001_3300009.. (original name was: 3300009363.a:Ga0115223_1009538); c00002_3300009.. (original name was: 3300009363.a:Ga0115223_1004671); c00003_3300009.. (original name was: 3300009363.a:Ga0115223_1008231); c00004_3300009.. (original name was: 3300009363.a:Ga0115223_1002622); c00005_3300009.. (original name was: 3300009363.a:Ga0115223_1007140); c00006_3300009.. (original name was: 3300009363.a:Ga0115223_1002348); c00008_3300009.. (original name was: 3300009363.a:Ga0115223_1004823); c00009_3300009.. (original name was: 3300009363.a:Ga0115223_1003174); c00010_3300009.. (original name was: 3300009363.a:Ga0115223_1007814); c00011_3300009.. (original name was: 3300009363.a:Ga0115223_1006028); c00012_3300009.. (original name was: 3300009363.a:Ga0115223_1002739); c00013_3300009.. (original name was: 3300009363.a:Ga0115223_1004277); c00014_3300009.. (original name was: 3300009363.a:Ga0115223_1005989); c00017_3300009.. (original name was: 3300009363.a:Ga0115223_1004071); c00018_3300009.. (original name was: 3300009363.a:Ga0115223_1000445); c00019_3300009.. (original name was: 3300009363.a:Ga0115223_1003918); c00020_3300009.. (original name was: 3300009363.a:Ga0115223_1005993); c00021_3300009.. (original name was: 3300009363.a:Ga0115223_1002842); c00022_3300009.. (original name was: 3300009363.a:Ga0115223_1001510); c00023_3300009.. (original name was: 3300009363.a:Ga0115223_1004171); c00024_3300009.. (original name was: 3300009363.a:Ga0115223_1001295); c00025_3300009.. (original name was: 3300009363.a:Ga0115223_1001690); c00026_3300009.. (original name was: 3300009363.a:Ga0115223_1002158); c00027_3300009.. (original name was: 3300009363.a:Ga0115223_1003698); c00028_3300009.. (original name was: 3300009363.a:Ga0115223_1003054); c00029_3300009.. (original name was: 3300009363.a:Ga0115223_1000576); c00030_3300009.. (original name was: 3300009363.a:Ga0115223_1002452); c00031_3300009.. (original name was: 3300009363.a:Ga0115223_1001608); c00032_3300009.. (original name was: 3300009363.a:Ga0115223_1002547); c00033_3300009.. (original name was: 3300009363.a:Ga0115223_1001029); c00034_3300009.. (original name was: 3300009363.a:Ga0115223_1008680); c00035_3300009.. (original name was: 3300009363.a:Ga0115223_1000227); c00036_3300009.. (original name was: 3300009363.a:Ga0115223_1002727); c00037_3300009.. (original name was: 3300009363.a:Ga0115223_1002512); c00038_3300009.. (original name was: 3300009363.a:Ga0115223_1005224); c00039_3300009.. (original name was: 3300009363.a:Ga0115223_1000877); c00040_3300009.. (original name was: 3300009363.a:Ga0115223_1000564); c00041_3300009.. (original name was: 3300009363.a:Ga0115223_1001514); c00042_3300009.. (original name was: 3300009363.a:Ga0115223_1001063); c00043_3300009.. (original name was: 3300009363.a:Ga0115223_1004504); c00044_3300009.. (original name was: 3300009363.a:Ga0115223_1005476); c00045_3300009.. (original name was: 3300009363.a:Ga0115223_1005693); c00046_3300009.. (original name was: 3300009363.a:Ga0115223_1005904); c00047_3300009.. (original name was: 3300009363.a:Ga0115223_1003667); c00048_3300009.. (original name was: 3300009363.a:Ga0115223_1001089); c00049_3300009.. (original name was: 3300009363.a:Ga0115223_1000820); c00050_3300009.. (original name was: 3300009363.a:Ga0115223_1000665); c00051_3300009.. (original name was: 3300009363.a:Ga0115223_1006479); c00052_3300009.. (original name was: 3300009363.a:Ga0115223_1005861); c00053_3300009.. (original name was: 3300009363.a:Ga0115223_1000918); c00054_3300009.. (original name was: 3300009363.a:Ga0115223_1001870); c00055_3300009.. (original name was: 3300009363.a:Ga0115223_1002250); c00056_3300009.. (original name was: 3300009363.a:Ga0115223_1007051); c00057_3300009.. (original name was: 3300009363.a:Ga0115223_1000384); c00058_3300009.. (original name was: 3300009363.a:Ga0115223_1000975); c00059_3300009.. (original name was: 3300009363.a:Ga0115223_1001688); c00060_3300009.. (original name was: 3300009363.a:Ga0115223_1005209); c00061_3300009.. (original name was: 3300009363.a:Ga0115223_1006709); c00062_3300009.. (original name was: 3300009363.a:Ga0115223_1000318); c00063_3300009.. (original name was: 3300009363.a:Ga0115223_1003624); c00064_3300009.. (original name was: 3300009363.a:Ga0115223_1001069); c00065_3300009.. (original name was: 3300009363.a:Ga0115223_1000441); c00066_3300009.. (original name was: 3300009363.a:Ga0115223_1003311); c00067_3300009.. (original name was: 3300009363.a:Ga0115223_1000959); c00068_3300009.. (original name was: 3300009363.a:Ga0115223_1000202); c00069_3300009.. (original name was: 3300009363.a:Ga0115223_1000884); c00070_3300009.. (original name was: 3300009363.a:Ga0115223_1007146); c00072_3300009.. (original name was: 3300009363.a:Ga0115223_1002831); c00073_3300009.. (original name was: 3300009363.a:Ga0115223_1009163); c00075_3300009.. (original name was: 3300009363.a:Ga0115223_1001553); c00076_3300009.. (original name was: 3300009363.a:Ga0115223_1002150); c00077_3300009.. (original name was: 3300009363.a:Ga0115223_1004692); c00078_3300009.. (original name was: 3300009363.a:Ga0115223_1000520); c00079_3300009.. (original name was: 3300009363.a:Ga0115223_1000535); c00080_3300009.. (original name was: 3300009363.a:Ga0115223_1000222); c00081_3300009.. (original name was: 3300009363.a:Ga0115223_1003984); c00082_3300009.. (original name was: 3300009363.a:Ga0115223_1008699); c00083_3300009.. (original name was: 3300009363.a:Ga0115223_1003893); c00084_3300009.. (original name was: 3300009363.a:Ga0115223_1001769); c00085_3300009.. (original name was: 3300009363.a:Ga0115223_1001909); c00086_3300009.. (original name was: 3300009363.a:Ga0115223_1005895); c00087_3300009.. (original name was: 3300009363.a:Ga0115223_1001483); c00088_3300009.. (original name was: 3300009363.a:Ga0115223_1001784); c00089_3300009.. (original name was: 3300009363.a:Ga0115223_1004045); c00090_3300009.. (original name was: 3300009363.a:Ga0115223_1000902); c00091_3300009.. (original name was: 3300009363.a:Ga0115223_1001192); c00092_3300009.. (original name was: 3300009363.a:Ga0115223_1006060); c00093_3300009.. (original name was: 3300009363.a:Ga0115223_1005688); c00094_3300009.. (original name was: 3300009363.a:Ga0115223_1005386); c00095_3300009.. (original name was: 3300009363.a:Ga0115223_1001485); c00096_3300009.. (original name was: 3300009363.a:Ga0115223_1000840); c00097_3300009.. (original name was: 3300009363.a:Ga0115223_1002666); c00098_3300009.. (original name was: 3300009363.a:Ga0115223_1001735); c00099_3300009.. (original name was: 3300009363.a:Ga0115223_1001448); c00100_3300009.. (original name was: 3300009363.a:Ga0115223_1001134); c00101_3300009.. (original name was: 3300009363.a:Ga0115223_1009580); c00102_3300009.. (original name was: 3300009363.a:Ga0115223_1006814); c00103_3300009.. (original name was: 3300009363.a:Ga0115223_1007966); c00104_3300009.. (original name was: 3300009363.a:Ga0115223_1005343); c00105_3300009.. (original name was: 3300009363.a:Ga0115223_1001976); c00106_3300009.. (original name was: 3300009363.a:Ga0115223_1002194); c00108_3300009.. (original name was: 3300009363.a:Ga0115223_1000882); c00109_3300009.. (original name was: 3300009363.a:Ga0115223_1000898); c00110_3300009.. (original name was: 3300009363.a:Ga0115223_1004959); c00111_3300009.. (original name was: 3300009363.a:Ga0115223_1003338); c00112_3300009.. (original name was: 3300009363.a:Ga0115223_1001704); c00113_3300009.. (original name was: 3300009363.a:Ga0115223_1007352); c00114_3300009.. (original name was: 3300009363.a:Ga0115223_1005353); c00115_3300009.. (original name was: 3300009363.a:Ga0115223_1004414); c00116_3300009.. (original name was: 3300009363.a:Ga0115223_1003777); c00117_3300009.. (original name was: 3300009363.a:Ga0115223_1000171); c00119_3300009.. (original name was: 3300009363.a:Ga0115223_1001880); c00120_3300009.. (original name was: 3300009363.a:Ga0115223_1001655); c00121_3300009.. (original name was: 3300009363.a:Ga0115223_1001612); c00122_3300009.. (original name was: 3300009363.a:Ga0115223_1000391); c00123_3300009.. (original name was: 3300009363.a:Ga0115223_1000129); c00124_3300009.. (original name was: 3300009363.a:Ga0115223_1000383); c00125_3300009.. (original name was: 3300009363.a:Ga0115223_1004522); c00126_3300009.. (original name was: 3300009363.a:Ga0115223_1003181); c00127_3300009.. (original name was: 3300009363.a:Ga0115223_1007522); c00128_3300009.. (original name was: 3300009363.a:Ga0115223_1004039); c00129_3300009.. (original name was: 3300009363.a:Ga0115223_1000731); c00130_3300009.. (original name was: 3300009363.a:Ga0115223_1001349); c00131_3300009.. (original name was: 3300009363.a:Ga0115223_1002001); c00132_3300009.. (original name was: 3300009363.a:Ga0115223_1004971); c00133_3300009.. (original name was: 3300009363.a:Ga0115223_1000751); c00134_3300009.. (original name was: 3300009363.a:Ga0115223_1000716); c00135_3300009.. (original name was: 3300009363.a:Ga0115223_1005778); c00136_3300009.. (original name was: 3300009363.a:Ga0115223_1003537); c00138_3300009.. (original name was: 3300009363.a:Ga0115223_1001045); c00139_3300009.. (original name was: 3300009363.a:Ga0115223_1007102); c00140_3300009.. (original name was: 3300009363.a:Ga0115223_1007424); c00141_3300009.. (original name was: 3300009363.a:Ga0115223_1002846); c00142_3300009.. (original name was: 3300009363.a:Ga0115223_1001760); c00143_3300009.. (original name was: 3300009363.a:Ga0115223_1000286); c00144_3300009.. (original name was: 3300009363.a:Ga0115223_1001517); c00145_3300009.. (original name was: 3300009363.a:Ga0115223_1002775); c00146_3300009.. (original name was: 3300009363.a:Ga0115223_1005799); c00147_3300009.. (original name was: 3300009363.a:Ga0115223_1001334); c00148_3300009.. (original name was: 3300009363.a:Ga0115223_1000692); c00149_3300009.. (original name was: 3300009363.a:Ga0115223_1002310); c00151_3300009.. (original name was: 3300009363.a:Ga0115223_1001392); c00152_3300009.. (original name was: 3300009363.a:Ga0115223_1004628); c00153_3300009.. (original name was: 3300009363.a:Ga0115223_1000640); c00154_3300009.. (original name was: 3300009363.a:Ga0115223_1001326); c00155_3300009.. (original name was: 3300009363.a:Ga0115223_1004246); c00156_3300009.. (original name was: 3300009363.a:Ga0115223_1001897); c00157_3300009.. (original name was: 3300009363.a:Ga0115223_1007206); c00158_3300009.. (original name was: 3300009363.a:Ga0115223_1001829); c00159_3300009.. (original name was: 3300009363.a:Ga0115223_1003164); c00160_3300009.. (original name was: 3300009363.a:Ga0115223_1003523); c00161_3300009.. (original name was: 3300009363.a:Ga0115223_1007590); c00162_3300009.. (original name was: 3300009363.a:Ga0115223_1000108); c00163_3300009.. (original name was: 3300009363.a:Ga0115223_1000890); c00164_3300009.. (original name was: 3300009363.a:Ga0115223_1001802); c00165_3300009.. (original name was: 3300009363.a:Ga0115223_1000719); c00166_3300009.. (original name was: 3300009363.a:Ga0115223_1007749); c00167_3300009.. (original name was: 3300009363.a:Ga0115223_1000985); c00168_3300009.. (original name was: 3300009363.a:Ga0115223_1000973); c00169_3300009.. (original name was: 3300009363.a:Ga0115223_1007933); c00170_3300009.. (original name was: 3300009363.a:Ga0115223_1001056); c00171_3300009.. (original name was: 3300009363.a:Ga0115223_1000249); c00172_3300009.. (original name was: 3300009363.a:Ga0115223_1000336); c00173_3300009.. (original name was: 3300009363.a:Ga0115223_1009504); c00174_3300009.. (original name was: 3300009363.a:Ga0115223_1002751); c00175_3300009.. (original name was: 3300009363.a:Ga0115223_1001942); c00176_3300009.. (original name was: 3300009363.a:Ga0115223_1000599); c00177_3300009.. (original name was: 3300009363.a:Ga0115223_1003821); c00178_3300009.. (original name was: 3300009363.a:Ga0115223_1003901); c00179_3300009.. (original name was: 3300009363.a:Ga0115223_1001277); c00180_3300009.. (original name was: 3300009363.a:Ga0115223_1001911); c00181_3300009.. (original name was: 3300009363.a:Ga0115223_1002611); c00183_3300009.. (original name was: 3300009363.a:Ga0115223_1001343); c00184_3300009.. (original name was: 3300009363.a:Ga0115223_1003578); c00186_3300009.. (original name was: 3300009363.a:Ga0115223_1003217); c00187_3300009.. (original name was: 3300009363.a:Ga0115223_1001228); c00188_3300009.. (original name was: 3300009363.a:Ga0115223_1005919); c00189_3300009.. (original name was: 3300009363.a:Ga0115223_1005435); c00190_3300009.. (original name was: 3300009363.a:Ga0115223_1003293); c00191_3300009.. (original name was: 3300009363.a:Ga0115223_1000369); c00192_3300009.. (original name was: 3300009363.a:Ga0115223_1000849); c00193_3300009.. (original name was: 3300009363.a:Ga0115223_1005007); c00194_3300009.. (original name was: 3300009363.a:Ga0115223_1006070); c00195_3300009.. (original name was: 3300009363.a:Ga0115223_1004696); c00196_3300009.. (original name was: 3300009363.a:Ga0115223_1006983); c00197_3300009.. (original name was: 3300009363.a:Ga0115223_1003190); c00198_3300009.. (original name was: 3300009363.a:Ga0115223_1002630); c00199_3300009.. (original name was: 3300009363.a:Ga0115223_1001821); c00200_3300009.. (original name was: 3300009363.a:Ga0115223_1000149); c00201_3300009.. (original name was: 3300009363.a:Ga0115223_1000875); c00202_3300009.. (original name was: 3300009363.a:Ga0115223_1004917); c00203_3300009.. (original name was: 3300009363.a:Ga0115223_1000871); c00204_3300009.. (original name was: 3300009363.a:Ga0115223_1002874); c00205_3300009.. (original name was: 3300009363.a:Ga0115223_1005780); c00206_3300009.. (original name was: 3300009363.a:Ga0115223_1000860); c00207_3300009.. (original name was: 3300009363.a:Ga0115223_1000282); c00208_3300009.. (original name was: 3300009363.a:Ga0115223_1009052); c00209_3300009.. (original name was: 3300009363.a:Ga0115223_1000729); c00210_3300009.. (original name was: 3300009363.a:Ga0115223_1003869); c00211_3300009.. (original name was: 3300009363.a:Ga0115223_1002882); c00212_3300009.. (original name was: 3300009363.a:Ga0115223_1002228); c00213_3300009.. (original name was: 3300009363.a:Ga0115223_1006130); c00214_3300009.. (original name was: 3300009363.a:Ga0115223_1000986); c00215_3300009.. (original name was: 3300009363.a:Ga0115223_1003792); c00217_3300009.. (original name was: 3300009363.a:Ga0115223_1002398); c00218_3300009.. (original name was: 3300009363.a:Ga0115223_1003366); c00219_3300009.. (original name was: 3300009363.a:Ga0115223_1000979); c00220_3300009.. (original name was: 3300009363.a:Ga0115223_1002163); c00222_3300009.. (original name was: 3300009363.a:Ga0115223_1008340); c00223_3300009.. (original name was: 3300009363.a:Ga0115223_1004419); c00224_3300009.. (original name was: 3300009363.a:Ga0115223_1000600); c00225_3300009.. (original name was: 3300009363.a:Ga0115223_1002795)

Compact view

c00007_3300009.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 37,343 nt. (total: 37,343 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 37343:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (X - X - pro - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_5

Search NORINE for peptide: strict or relaxed

AMP-binding (522..908): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfpKVsngaK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 40% (weak)

ctg7_6

Search NORINE for peptide: strict or relaxed

AMP-binding (462..845): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DViEnstVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 50% (weak)

AMP-binding (1491..1877): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVlaL-LIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (2532..2913): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVilVtAIvK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (3587..3982): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAllmGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg7_7

Search NORINE for peptide: strict or relaxed

AMP-binding (0..300): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKlfGtVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (957..1347): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFfVAlifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (1997..2374): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALllGAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

c00015_3300009.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 8,003 nt. (total: 8,003 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00016_3300009.. - Region 1 - LAP

Download region GenBank file

Location: 1 - 13,570 nt. (total: 13,570 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00071_3300009.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 18,718 nt. (total: 18,718 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg71_8 - Putative Class II

ctg71_4 leader / core peptide: MYKRYNEEIIDDLAEMSDAEIEDLLGA - GCGIVCDhbLDhbLDCNDhbGDhbLGRWWGCC
ctg71_10 leader / core peptide: MFIRKLIAVTAA - DhbLALALQVADhbDhaNIPQDhbVEVDhbQLDhbDhaDhaDhaDhaPEYLCDIFPLFCGL
allorf_17308_17388 leader / core peptide: VLFVADFGVVGA - WCQVVEADhbDhaRHDhaCV

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg71_4 - Class II

Cleavage pHMM score: 0.60

RODEO score: 0

Monoisotopic mass: 2459.1 Da

Molecular weight: 2460.9 Da

Number of bridges: 4

ctg71_10 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 4189.2 Da

Molecular weight: 4191.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4209.8 Da N = 1; 4227.8 Da N = 2; 4245.8 Da N = 3; 4263.9 Da N = 4; 4281.9 Da N = 5; 4299.9 Da N = 6; 4317.9 Da N = 7; 4335.9 Da N = 8

allorf_17308_17388 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 1549.7 Da

Molecular weight: 1550.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1568.8 Da N = 1

c00074_3300009.. - Region 1 - bacteriocin

Download region GenBank file

Location: 4,253 - 13,080 nt. (total: 8,828 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00107_3300009.. - Region 1 - NRPS

Download region GenBank file

Location: 8,654 - 63,470 nt. (total: 54,817 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 8653 - 63470:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg107_35

Search NORINE for peptide: strict or relaxed

AMP-binding (450..838): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSmIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

ctg107_41

Search NORINE for peptide: strict or relaxed

AMP-binding (537..932): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNiSMIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

c00118_3300009.. - Region 1 - LAP

Download region GenBank file

Location: 1 - 10,317 nt. (total: 10,317 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00137_3300009.. - Region 1 - NRPS,T1PKS,transAT-PKS

Download region GenBank file

Location: 1 - 34,127 nt. (total: 34,127 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
transAT-PKS: (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 34127:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal) + (mal - D-ile) + (val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg137_10

PKS_AT (550..842): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.3
Methoxymalonyl-CoA: 38.0
inactive: 37.4
Methylmalonyl-CoA: 30.9
Propionyl-CoA: 19.8
fatty_acid: 15.7
Ethylmalonyl-CoA: 9.4
Benzoyl-CoA: 9.4
2-Methylbutyryl-CoA: 6.2
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; inactive: 54.2%

ctg137_11

Search NORINE for peptide: strict or relaxed

AMP-binding (458..858): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWmGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg137_12

Search NORINE for peptide: strict or relaxed

AMP-binding (1201..1603): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DGyFLGgVFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

ctg137_15

PKS_AT (6..290): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.0
Methylmalonyl-CoA: 53.8
Methoxymalonyl-CoA: 52.8
inactive: 28.0
2-Methylbutyryl-CoA: 19.9
CHC-CoA: 18.8
Propionyl-CoA: 15.5
trans-1,2-CPDA: 12.8
Ethylmalonyl-CoA: 12.8
Isobutyryl-CoA: 12.2
fatty_acid: 11.1
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 54.2%; inactive: 54.2%

c00150_3300009.. - Region 1 - LAP

Download region GenBank file

Location: 8,572 - 25,962 nt. (total: 17,391 nt) Show pHMM detection rules used

Region on contig edge.

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00182_3300009.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,272 nt. (total: 13,272 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13272:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg182_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..384): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiFqvGMVtK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (1844..2227): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpFLfGLivK
Nearest Stachelhaus code:: phg
Stachelhaus code match:: 60% (weak)

c00185_3300009.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 4,159 - 26,456 nt. (total: 22,298 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg185_14 - Putative Class II

allorf_04589_04822 leader / core peptide: VRSASVSAAA - PDMEDhbDhbPDhaDhbPRDhaRDhaVAMQEGDhaDhaAPDhaGPAADhbIAVRWDhbGWNRADhaRRDhaARAGKEGFDDhaDhaGDhbIDhbPDhbDhbPVRC
allorf_17173_17283 leader / core peptide: MKPWHSQEMVQTA - PMVRVPGDhbVQRPPAWVFDhaDCEDhaDha
allorf_17157_17318 leader / core peptide: MSDMNFLKEVADHELSQSEKTQAGG - LWDhbVPGDhbRDhbIGAVCDhbIDhaWECHGFICGWN
allorf_26258_26440 leader / core peptide: MVFTSSPNLACAGLVAGTVFPHFLLVKESHIVHVVLRQAITPFFDAVIVAPASQGA - AVCDha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_04589_04822 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 6689.4 Da

Molecular weight: 6693.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6711.3 Da N = 1; 6729.4 Da N = 2; 6747.4 Da N = 3; 6765.4 Da N = 4; 6783.4 Da N = 5; 6801.4 Da N = 6; 6819.5 Da N = 7; 6837.5 Da N = 8; 6855.5 Da N = 9; 6873.5 Da N = 10; 6891.5 Da N = 11; 6909.6 Da N = 12; 6927.6 Da N = 13; 6945.6 Da N = 14; 6963.6 Da N = 15; 6981.6 Da N = 16; 6999.7 Da N = 17; 7017.7 Da N = 18

allorf_17173_17283 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 2472.2 Da

Molecular weight: 2473.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2491.8 Da N = 1; 2509.8 Da N = 2; 2527.9 Da N = 3

allorf_17157_17318 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 3016.5 Da

Molecular weight: 3018.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3036.5 Da N = 1; 3054.5 Da N = 2

allorf_26258_26440 - Class II

Cleavage pHMM score: -5.90

RODEO score: 0

Monoisotopic mass: 360.2 Da

Molecular weight: 360.4 Da

Number of bridges: 1

c00216_3300009.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 27,496 nt. (total: 27,496 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27496:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg216_1

Search NORINE for peptide: strict or relaxed

AMP-binding (461..862): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DItnfGVmWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

PKS_AT (1568..1856): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 118.8
inactive: 61.2
Methoxymalonyl-CoA: 37.5
Methylmalonyl-CoA: 33.6
Propionyl-CoA: 32.0
Isobutyryl-CoA: 15.4
CHC-CoA: 10.1
2-Methylbutyryl-CoA: 9.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 62.5%

c00221_3300009.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 37,672 nt. (total: 37,672 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 37672:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg221_1

Search NORINE for peptide: strict or relaxed

PKS_AT (89..385): pk

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.8
Ethylmalonyl-CoA: 115.9
Methoxymalonyl-CoA: 110.9
2-Methylbutyryl-CoA: 88.9
Propionyl-CoA: 79.7
trans-1,2-CPDA: 71.4
CHC-CoA: 61.9
Benzoyl-CoA: 31.5
3-Methylbutyryl-CoA: 31.2
Isobutyryl-CoA: 25.3
Malonyl-CoA: 24.4
Acetyl-CoA: 13.1
inactive: 0.0
fatty_acid: 0.0

ATSignature: Methoxymalonyl-CoA, 2-Methylbutyryl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 66.7%; 2-Methylbutyryl-CoA: 66.7%; Methylmalonyl-CoA: 62.5%

PKS_AT (1066..1358): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 105.1
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 61.3
inactive: 60.2
Ethylmalonyl-CoA: 42.3
Isobutyryl-CoA: 32.3
Propionyl-CoA: 32.0
Benzoyl-CoA: 26.8
CHC-CoA: 21.7
2-Methylbutyryl-CoA: 18.2
trans-1,2-CPDA: 17.8
3-Methylbutyryl-CoA: 17.0
fatty_acid: 14.3
Acetyl-CoA: 12.2

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

AMP-binding (2576..2912): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQVGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg221_12

CAL_domain (11..454): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 79.8
NH2: 32.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1157..1440): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.3
inactive: 59.5
Methylmalonyl-CoA: 51.8
Methoxymalonyl-CoA: 49.0
Propionyl-CoA: 20.4
Benzoyl-CoA: 20.2
Ethylmalonyl-CoA: 17.0
Isobutyryl-CoA: 12.6
CHC-CoA: 11.9
Acetyl-CoA: 11.6
trans-1,2-CPDA: 10.0
3-Methylbutyryl-CoA: 9.0
2-Methylbutyryl-CoA: 6.0
fatty_acid: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%