3300010371_18 - 36 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300010.. (original name was: 3300010371.a:Ga0134125_10038786)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS	1	5,305

c00002_3300010.. (original name was: 3300010371.a:Ga0134125_10033621)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	1	5,714

c00007_3300010.. (original name was: 3300010371.a:Ga0134125_10000007)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	lanthipeptide	289,753	313,025

c00010_3300010.. (original name was: 3300010371.a:Ga0134125_10000010)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	bacteriocin	293,075	305,003

c00011_3300010.. (original name was: 3300010371.a:Ga0134125_10000057)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	TfuA-related	3,056	25,726
Region 11.2	bacteriocin	136,166	148,208

c00015_3300010.. (original name was: 3300010371.a:Ga0134125_10000020)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS,T1PKS	1	93,101
Region 15.2	T1PKS,NRPS-like	154,868	223,202

c00017_3300010.. (original name was: 3300010371.a:Ga0134125_10000017)

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	lanthipeptide	56,286	80,982
Region 17.2	ladderane	125,229	166,443

c00019_3300010.. (original name was: 3300010371.a:Ga0134125_10000016)

Region	Type	From	To	Most similar known cluster		Similarity
Region 19.1	lanthipeptide	80,452	103,661

c00022_3300010.. (original name was: 3300010371.a:Ga0134125_10039661)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	1	5,244

c00025_3300010.. (original name was: 3300010371.a:Ga0134125_10004190)

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	NRPS	1	16,527

c00026_3300010.. (original name was: 3300010371.a:Ga0134125_10000019)

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	lanthipeptide	151,867	174,251

c00028_3300010.. (original name was: 3300010371.a:Ga0134125_10001915)

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	T1PKS	1	25,089

c00032_3300010.. (original name was: 3300010371.a:Ga0134125_10000009)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	lanthipeptide	1	14,310
Region 32.2	bacteriocin	42,067	52,297

c00039_3300010.. (original name was: 3300010371.a:Ga0134125_10000042)

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	NRPS,T1PKS	140,796	189,573

c00040_3300010.. (original name was: 3300010371.a:Ga0134125_10001109)

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	T1PKS,NRPS	1	33,783

c00041_3300010.. (original name was: 3300010371.a:Ga0134125_10000136)

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	NRPS,T1PKS	76,152	107,799

c00043_3300010.. (original name was: 3300010371.a:Ga0134125_10017512)

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	NRPS,T1PKS	1	8,007

c00045_3300010.. (original name was: 3300010371.a:Ga0134125_10030271)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS	1	6,027

c00050_3300010.. (original name was: 3300010371.a:Ga0134125_10000028)

Region	Type	From	To	Most similar known cluster		Similarity
Region 50.1	terpene	192,859	213,800

c00051_3300010.. (original name was: 3300010371.a:Ga0134125_10024793)

Region	Type	From	To	Most similar known cluster		Similarity
Region 51.1	NRPS	1	6,679

c00054_3300010.. (original name was: 3300010371.a:Ga0134125_10000063)

Region	Type	From	To	Most similar known cluster		Similarity
Region 54.1	NRPS,T1PKS	69,902	127,744

c00058_3300010.. (original name was: 3300010371.a:Ga0134125_10000305)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	NRPS,T1PKS	1	68,167

c00060_3300010.. (original name was: 3300010371.a:Ga0134125_10000065)

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	terpene	109,295	130,851

c00064_3300010.. (original name was: 3300010371.a:Ga0134125_10000116)

Region	Type	From	To	Most similar known cluster		Similarity
Region 64.1	lanthipeptide	54,620	77,607

c00069_3300010.. (original name was: 3300010371.a:Ga0134125_10034549)

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	NRPS	1	5,640

c00070_3300010.. (original name was: 3300010371.a:Ga0134125_10000046)

Region	Type	From	To	Most similar known cluster		Similarity
Region 70.1	lanthipeptide	142,642	165,890

c00072_3300010.. (original name was: 3300010371.a:Ga0134125_10006095)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	arylpolyene	1	13,673

c00081_3300010.. (original name was: 3300010371.a:Ga0134125_10000110)

Region	Type	From	To	Most similar known cluster		Similarity
Region 81.1	NRPS,T1PKS	651	80,933

c00082_3300010.. (original name was: 3300010371.a:Ga0134125_10000307)

Region	Type	From	To	Most similar known cluster		Similarity
Region 82.1	lanthipeptide	40,841	68,057

c00088_3300010.. (original name was: 3300010371.a:Ga0134125_10000077)

Region	Type	From	To	Most similar known cluster		Similarity
Region 88.1	T3PKS	4,536	45,597

c00094_3300010.. (original name was: 3300010371.a:Ga0134125_10000597)

Region	Type	From	To	Most similar known cluster		Similarity
Region 94.1	NRPS-like	4,289	47,894

c00099_3300010.. (original name was: 3300010371.a:Ga0134125_10000024)

Region	Type	From	To	Most similar known cluster		Similarity
Region 99.1	bacteriocin	83,010	93,951

Region	Type	From	To	Similarity
Region 1.1	NRPS	1	5,305
Region 2.1	NRPS	1	5,714
Region 7.1	lanthipeptide	289,753	313,025
Region 10.1	bacteriocin	293,075	305,003
Region 11.1	TfuA-related	3,056	25,726
Region 11.2	bacteriocin	136,166	148,208
Region 15.1	NRPS,T1PKS	1	93,101
Region 15.2	T1PKS,NRPS-like	154,868	223,202
Region 17.1	lanthipeptide	56,286	80,982
Region 17.2	ladderane	125,229	166,443
Region 19.1	lanthipeptide	80,452	103,661
Region 22.1	NRPS	1	5,244
Region 25.1	NRPS	1	16,527
Region 26.1	lanthipeptide	151,867	174,251
Region 28.1	T1PKS	1	25,089
Region 32.1	lanthipeptide	1	14,310
Region 32.2	bacteriocin	42,067	52,297
Region 39.1	NRPS,T1PKS	140,796	189,573
Region 40.1	T1PKS,NRPS	1	33,783
Region 41.1	NRPS,T1PKS	76,152	107,799
Region 43.1	NRPS,T1PKS	1	8,007
Region 45.1	NRPS	1	6,027
Region 50.1	terpene	192,859	213,800
Region 51.1	NRPS	1	6,679
Region 54.1	NRPS,T1PKS	69,902	127,744
Region 58.1	NRPS,T1PKS	1	68,167
Region 60.1	terpene	109,295	130,851
Region 64.1	lanthipeptide	54,620	77,607
Region 69.1	NRPS	1	5,640
Region 70.1	lanthipeptide	142,642	165,890
Region 72.1	arylpolyene	1	13,673
Region 81.1	NRPS,T1PKS	651	80,933
Region 82.1	lanthipeptide	40,841	68,057
Region 88.1	T3PKS	4,536	45,597
Region 94.1	NRPS-like	4,289	47,894
Region 99.1	bacteriocin	83,010	93,951

No secondary metabolite regions were found in these records:: c00003_3300010.. (original name was: 3300010371.a:Ga0134125_10000467); c00004_3300010.. (original name was: 3300010371.a:Ga0134125_10053438); c00005_3300010.. (original name was: 3300010371.a:Ga0134125_10000030); c00006_3300010.. (original name was: 3300010371.a:Ga0134125_10005181); c00008_3300010.. (original name was: 3300010371.a:Ga0134125_10001268); c00009_3300010.. (original name was: 3300010371.a:Ga0134125_10000074); c00012_3300010.. (original name was: 3300010371.a:Ga0134125_10002191); c00013_3300010.. (original name was: 3300010371.a:Ga0134125_10000059); c00014_3300010.. (original name was: 3300010371.a:Ga0134125_10000067); c00016_3300010.. (original name was: 3300010371.a:Ga0134125_10001278); c00018_3300010.. (original name was: 3300010371.a:Ga0134125_10000384); c00020_3300010.. (original name was: 3300010371.a:Ga0134125_10000797); c00021_3300010.. (original name was: 3300010371.a:Ga0134125_10001135); c00023_3300010.. (original name was: 3300010371.a:Ga0134125_10000210); c00024_3300010.. (original name was: 3300010371.a:Ga0134125_10000409); c00027_3300010.. (original name was: 3300010371.a:Ga0134125_10000076); c00029_3300010.. (original name was: 3300010371.a:Ga0134125_10000144); c00030_3300010.. (original name was: 3300010371.a:Ga0134125_10018333); c00031_3300010.. (original name was: 3300010371.a:Ga0134125_10001367); c00033_3300010.. (original name was: 3300010371.a:Ga0134125_10000529); c00034_3300010.. (original name was: 3300010371.a:Ga0134125_10050061); c00035_3300010.. (original name was: 3300010371.a:Ga0134125_10000587); c00036_3300010.. (original name was: 3300010371.a:Ga0134125_10001488); c00037_3300010.. (original name was: 3300010371.a:Ga0134125_10000026); c00038_3300010.. (original name was: 3300010371.a:Ga0134125_10063604); c00042_3300010.. (original name was: 3300010371.a:Ga0134125_10000277); c00044_3300010.. (original name was: 3300010371.a:Ga0134125_10003198); c00046_3300010.. (original name was: 3300010371.a:Ga0134125_10001743); c00047_3300010.. (original name was: 3300010371.a:Ga0134125_10006434); c00048_3300010.. (original name was: 3300010371.a:Ga0134125_10001209); c00049_3300010.. (original name was: 3300010371.a:Ga0134125_10031004); c00052_3300010.. (original name was: 3300010371.a:Ga0134125_10000548); c00053_3300010.. (original name was: 3300010371.a:Ga0134125_10000262); c00055_3300010.. (original name was: 3300010371.a:Ga0134125_10023221); c00056_3300010.. (original name was: 3300010371.a:Ga0134125_10000720); c00057_3300010.. (original name was: 3300010371.a:Ga0134125_10000817); c00059_3300010.. (original name was: 3300010371.a:Ga0134125_10003894); c00061_3300010.. (original name was: 3300010371.a:Ga0134125_10037680); c00062_3300010.. (original name was: 3300010371.a:Ga0134125_10000259); c00063_3300010.. (original name was: 3300010371.a:Ga0134125_10000316); c00065_3300010.. (original name was: 3300010371.a:Ga0134125_10017767); c00066_3300010.. (original name was: 3300010371.a:Ga0134125_10048772); c00067_3300010.. (original name was: 3300010371.a:Ga0134125_10000082); c00068_3300010.. (original name was: 3300010371.a:Ga0134125_10000281); c00071_3300010.. (original name was: 3300010371.a:Ga0134125_10001518); c00073_3300010.. (original name was: 3300010371.a:Ga0134125_10000081); c00074_3300010.. (original name was: 3300010371.a:Ga0134125_10000479); c00075_3300010.. (original name was: 3300010371.a:Ga0134125_10000071); c00076_3300010.. (original name was: 3300010371.a:Ga0134125_10001138); c00077_3300010.. (original name was: 3300010371.a:Ga0134125_10000168); c00078_3300010.. (original name was: 3300010371.a:Ga0134125_10010463); c00079_3300010.. (original name was: 3300010371.a:Ga0134125_10000031); c00080_3300010.. (original name was: 3300010371.a:Ga0134125_10000707); c00083_3300010.. (original name was: 3300010371.a:Ga0134125_10000705); c00084_3300010.. (original name was: 3300010371.a:Ga0134125_10095442); c00085_3300010.. (original name was: 3300010371.a:Ga0134125_10000108); c00086_3300010.. (original name was: 3300010371.a:Ga0134125_10001757); c00087_3300010.. (original name was: 3300010371.a:Ga0134125_10000242); c00089_3300010.. (original name was: 3300010371.a:Ga0134125_10001418); c00090_3300010.. (original name was: 3300010371.a:Ga0134125_10000396); c00091_3300010.. (original name was: 3300010371.a:Ga0134125_10001116); c00092_3300010.. (original name was: 3300010371.a:Ga0134125_10000799); c00093_3300010.. (original name was: 3300010371.a:Ga0134125_10004776); c00095_3300010.. (original name was: 3300010371.a:Ga0134125_10000341); c00096_3300010.. (original name was: 3300010371.a:Ga0134125_10001156); c00097_3300010.. (original name was: 3300010371.a:Ga0134125_10000053); c00098_3300010.. (original name was: 3300010371.a:Ga0134125_10001752); c00100_3300010.. (original name was: 3300010371.a:Ga0134125_10000223); c00101_3300010.. (original name was: 3300010371.a:Ga0134125_10000416); c00102_3300010.. (original name was: 3300010371.a:Ga0134125_10000018); c00103_3300010.. (original name was: 3300010371.a:Ga0134125_10001323)

Compact view

c00001_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,305 nt. (total: 5,305 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5305:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1

Search NORINE for peptide: strict or relaxed

AMP-binding (734..1119): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAcQlaLIlK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00002_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,714 nt. (total: 5,714 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5714:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_1

Search NORINE for peptide: strict or relaxed

AMP-binding (869..1255): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAcQlaLIlK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00007_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 289,753 - 313,025 nt. (total: 23,273 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg7_247 - Putative Class II

ctg7_245 leader / core peptide: MNKIDVIRAWKDPVYRAGLSRAEIACLPGHPSGLLEIDEEQLKSASGG - AVVDhbDhbNRLCDhbMQDhaFNNWRDhaCCP
ctg7_246 leader / core peptide: MNRVDVVRAWKDPLYRASLTAEERDCLPGHPSGIIELEDDLLKSVAAG - ALDhbDhbAQQCDhbEFDhaFNNFRRCCPK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg7_245 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 2440.1 Da

Molecular weight: 2441.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2459.8 Da N = 1; 2477.9 Da N = 2

ctg7_246 - Class II

Cleavage pHMM score: -3.60

RODEO score: 0

Monoisotopic mass: 2492.2 Da

Molecular weight: 2493.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2511.8 Da N = 1

c00010_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 293,075 - 305,003 nt. (total: 11,929 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00011_3300010.. - Region 1 - TfuA-related

Download region GenBank file

Location: 3,056 - 25,726 nt. (total: 22,671 nt) Show pHMM detection rules used

TfuA-related: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00011_3300010.. - Region 2 - bacteriocin

Download region GenBank file

Location: 136,166 - 148,208 nt. (total: 12,043 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00015_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 93,101 nt. (total: 93,101 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 93101:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (lys - ala - X - pro - leu) + (ohmal) + (gly - val) + (thr - X) + (gly - leu - X) + (mal - ala - asp - X - phe - pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_1

Search NORINE for peptide: strict or relaxed

PKS_AT (522..809): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.4
inactive: 82.3
Methylmalonyl-CoA: 74.7
Methoxymalonyl-CoA: 73.8
Propionyl-CoA: 42.1
2-Methylbutyryl-CoA: 31.9
Isobutyryl-CoA: 30.0
Ethylmalonyl-CoA: 29.3
Acetyl-CoA: 24.9
trans-1,2-CPDA: 24.2
CHC-CoA: 22.6
Benzoyl-CoA: 20.0
fatty_acid: 11.5
3-Methylbutyryl-CoA: 9.1

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

AMP-binding (1475..1867): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2523..2915): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DaTKIGqVaK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 70% (weak)

AMP-binding (3583..3985): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (4645..5036): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlLGaVcK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (5698..6100): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAqVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

ctg15_2

Search NORINE for peptide: strict or relaxed

CAL_domain (151..453): pk

minowa: NH2

Prediction, score:

NH2: 194.1
Acetyl-CoA: 61.9
fatty_acid: 29.2
AHBA: 23.3
shikimic_acid: 17.6

AMP-binding (1135..1539): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DiFqLGMVyK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (2199..2598): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

A-OX (3279..4050): X

ctg15_5

Search NORINE for peptide: strict or relaxed

AMP-binding (510..903): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1563..2018): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: dPRNmVlraK
Nearest Stachelhaus code:: aad
Stachelhaus code match:: 50% (weak)

ctg15_6

Search NORINE for peptide: strict or relaxed

AMP-binding (517..913): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIaQvtLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (1582..1959): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg15_8

PKS_AT (537..842): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 153.4
inactive: 80.8
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 48.2
Isobutyryl-CoA: 34.3
Propionyl-CoA: 21.1
CHC-CoA: 19.1
2-Methylbutyryl-CoA: 15.9
Ethylmalonyl-CoA: 13.4
fatty_acid: 11.6
3-Methylbutyryl-CoA: 9.5
Benzoyl-CoA: 9.0
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%; inactive: 62.5%

ctg15_9

Search NORINE for peptide: strict or relaxed

CAL_domain (45..490): pk

minowa: NH2

Prediction, score:

NH2: 194.4
fatty_acid: 31.4
Acetyl-CoA: 8.8
AHBA: 7.5
shikimic_acid: 0.0

AMP-binding (1177..1582): lys

NRPSPredictor2: lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: lys

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDLGcVsK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (2236..2624): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3274..3660): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (4321..4723): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFmAHV-K
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (5389..5783): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DALfTGqVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

c00015_3300010.. - Region 2 - NRPS-like,T1PKS

Download region GenBank file

Location: 154,868 - 223,202 nt. (total: 68,335 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00017_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 56,286 - 80,982 nt. (total: 24,697 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00017_3300010.. - Region 2 - ladderane

Download region GenBank file

Location: 125,229 - 166,443 nt. (total: 41,215 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00019_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 80,452 - 103,661 nt. (total: 23,210 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg19_79 - Putative Class II

ctg19_78 leader / core peptide: MHKNIDVVRAWRDEEYRNSLTQQELSSLPESPAGLATVDDTALRSTTGA - LDhaLHCDhbGDhbDhbFVDDhaCVKPGQQCP
allorf_102731_102823 leader / core peptide: VKGDKNHIALKGRRQRLSVAAA - PDhaGCDhaDhaLG
allorf_096631_096816 leader / core peptide: VVKGTQCSWATMTSKIGLVFDSPKCLVGGQLELGELRLG - EGDhaHDhaDhaIEDhaCLWNDhaDhaHLEGEDhaY

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg19_78 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 2230.1 Da

Molecular weight: 2231.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2249.6 Da N = 1; 2267.6 Da N = 2

allorf_102731_102823 - Class II

Cleavage pHMM score: -4.00

RODEO score: 0

Monoisotopic mass: 652.3 Da

Molecular weight: 652.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 670.7 Da N = 1; 688.7 Da N = 2

allorf_096631_096816 - Class II

Cleavage pHMM score: -5.90

RODEO score: 0

Monoisotopic mass: 2311.0 Da

Molecular weight: 2312.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2330.4 Da N = 1; 2348.4 Da N = 2; 2366.4 Da N = 3; 2384.4 Da N = 4; 2402.5 Da N = 5; 2420.5 Da N = 6

c00022_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,244 nt. (total: 5,244 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5244:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_2

Search NORINE for peptide: strict or relaxed

AMP-binding (439..843): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

c00025_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 16,527 nt. (total: 16,527 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 16527:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-gly) + (X - gly - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg25_1

Search NORINE for peptide: strict or relaxed

AMP-binding (475..884): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (1563..1964): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2632..3032): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWaGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg25_2

Search NORINE for peptide: strict or relaxed

AMP-binding (602..1001): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

c00026_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 151,867 - 174,251 nt. (total: 22,385 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00028_3300010.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 25,089 nt. (total: 25,089 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25089:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg28_8

PKS_AT (541..703): pk

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

c00032_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 14,310 nt. (total: 14,310 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg32_3 - Putative Class II

ctg32_2 leader / core peptide: MKKIDLTRAFRDEDYFLSLTASERASLPAHPAAMIEVSEEELRAVAGA - DhbDhbEACDhbRDhaGFCDhaPCPGHPCV
allorf_004343_004432 leader / core peptide: MALPSAARRQVPAA - DGGACHDQVHEDhaHHL

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg32_2 - Class II

Cleavage pHMM score: 4.20

RODEO score: 0

Monoisotopic mass: 1961.8 Da

Molecular weight: 1963.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1981.2 Da N = 1

allorf_004343_004432 - Class II

Cleavage pHMM score: -3.50

RODEO score: 0

Monoisotopic mass: 1622.7 Da

Molecular weight: 1623.7 Da

Number of bridges: 1

c00032_3300010.. - Region 2 - bacteriocin

Download region GenBank file

Location: 42,067 - 52,297 nt. (total: 10,231 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00039_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 140,796 - 189,573 nt. (total: 48,778 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 140795 - 189573:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - asp - ala - ala - X - cys) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg39_132

Search NORINE for peptide: strict or relaxed

CAL_domain (83..417): pk

minowa: NH2

Prediction, score:

NH2: 168.4
Acetyl-CoA: 48.0
fatty_acid: 13.6
AHBA: 10.6
shikimic_acid: 0.0

AMP-binding (1101..1490): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DiFNNALTfK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

AMP-binding (2149..2548): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (3200..3599): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DlWFvavVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (4252..4644): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (5304..5724): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (6391..6788): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSmIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

ctg39_133

PKS_AT (536..836): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.7
inactive: 103.2
Methylmalonyl-CoA: 76.9
Methoxymalonyl-CoA: 66.0
Isobutyryl-CoA: 45.0
Ethylmalonyl-CoA: 43.0
Propionyl-CoA: 41.6
Benzoyl-CoA: 38.4
2-Methylbutyryl-CoA: 37.0
CHC-CoA: 30.8
fatty_acid: 19.2
trans-1,2-CPDA: 18.5
Acetyl-CoA: 16.2
3-Methylbutyryl-CoA: 7.4

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

c00040_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 33,783 nt. (total: 33,783 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 33783:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - X) + (mal - ser - ser - tyr - ser - gly - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg40_1

Search NORINE for peptide: strict or relaxed

PKS_AT (495..792): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 191.9
inactive: 123.2
Methoxymalonyl-CoA: 73.8
Methylmalonyl-CoA: 71.7
Propionyl-CoA: 55.6
Ethylmalonyl-CoA: 42.9
Isobutyryl-CoA: 32.5
2-Methylbutyryl-CoA: 31.8
Acetyl-CoA: 22.2
Benzoyl-CoA: 21.6
CHC-CoA: 21.1
trans-1,2-CPDA: 11.3
fatty_acid: 9.5
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Propionyl-CoA: 54.2%

AMP-binding (1456..1860): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2855..3259): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4253..4640): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (5636..6038): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (7039..7412): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (8076..8464): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg40_2

Search NORINE for peptide: strict or relaxed

AMP-binding (819..1215): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1876..2294): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvfraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

c00041_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 76,152 - 107,799 nt. (total: 31,648 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 76151 - 107799:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly) + (mal - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg41_91

Search NORINE for peptide: strict or relaxed

PKS_AT (534..823): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.9
inactive: 103.0
Methoxymalonyl-CoA: 79.2
Methylmalonyl-CoA: 64.6
Propionyl-CoA: 46.7
Isobutyryl-CoA: 35.6
Ethylmalonyl-CoA: 35.6
2-Methylbutyryl-CoA: 30.6
fatty_acid: 30.1
CHC-CoA: 30.1
Acetyl-CoA: 22.8
Benzoyl-CoA: 20.1
trans-1,2-CPDA: 16.4
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

AMP-binding (1499..1905): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFdLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

ctg41_92

Search NORINE for peptide: strict or relaxed

AMP-binding (640..1011): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

c00043_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 8,007 nt. (total: 8,007 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg43_2

Search NORINE for peptide: strict or relaxed

AMP-binding (512..916): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpWdFGiIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

PKS_AT (1647..1934): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.5
inactive: 101.1
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 61.4
Propionyl-CoA: 47.4
Ethylmalonyl-CoA: 32.4
Acetyl-CoA: 25.5
2-Methylbutyryl-CoA: 25.2
Isobutyryl-CoA: 23.5
Benzoyl-CoA: 23.5
trans-1,2-CPDA: 19.6
CHC-CoA: 19.6
fatty_acid: 12.0
3-Methylbutyryl-CoA: 5.5

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

c00045_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,027 nt. (total: 6,027 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6027:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg45_1

Search NORINE for peptide: strict or relaxed

AMP-binding (597..981): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAcQlaLIlK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

ctg45_2

Search NORINE for peptide: strict or relaxed

AMP-binding (3..194): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ---QLaLVaK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 50% (weak)

c00050_3300010.. - Region 1 - terpene

Download region GenBank file

Location: 192,859 - 213,800 nt. (total: 20,942 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00051_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,679 nt. (total: 6,679 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6679:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg51_1

Search NORINE for peptide: strict or relaxed

AMP-binding (551..951): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWaGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1618..2020): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00054_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 69,902 - 127,744 nt. (total: 57,843 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 69901 - 127744:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ile - ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg54_83

Search NORINE for peptide: strict or relaxed

AMP-binding (515..914): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEniGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

ctg54_84

Search NORINE for peptide: strict or relaxed

PKS_AT (547..839): mmal

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 109.3
Methoxymalonyl-CoA: 92.7
Ethylmalonyl-CoA: 90.8
Isobutyryl-CoA: 81.2
Benzoyl-CoA: 81.0
Propionyl-CoA: 78.5
Malonyl-CoA: 72.9
3-Methylbutyryl-CoA: 68.0
2-Methylbutyryl-CoA: 66.8
Acetyl-CoA: 56.4
trans-1,2-CPDA: 40.4
CHC-CoA: 37.6
fatty_acid: 36.7
inactive: 16.5

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%; Benzoyl-CoA: 58.3%

PKS_AT (955..1246): pk

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 126.7
Malonyl-CoA: 102.5
Methoxymalonyl-CoA: 97.2
Isobutyryl-CoA: 91.6
Ethylmalonyl-CoA: 83.3
Propionyl-CoA: 65.3
2-Methylbutyryl-CoA: 54.8
CHC-CoA: 52.1
trans-1,2-CPDA: 51.2
Benzoyl-CoA: 45.9
Acetyl-CoA: 39.1
inactive: 32.2
3-Methylbutyryl-CoA: 19.8
fatty_acid: 16.2

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

AMP-binding (2347..2749): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGiTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (3423..3811): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvFFLGaVFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

c00058_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 68,167 nt. (total: 68,167 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 68167:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (asp - cys - gly) + (D-asn) + (asn) + (X - ser) + (X) + (asn) + (D-thr - D-cys - X - ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_1

Search NORINE for peptide: strict or relaxed

AMP-binding (517..921): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiEccGSVvK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

ctg58_2

Search NORINE for peptide: strict or relaxed

AMP-binding (515..920): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DYWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2045..2466): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSmVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

AMP-binding (3590..3997): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMENvGaIaK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

PKS_AT (4725..5023): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.3
inactive: 115.9
Methoxymalonyl-CoA: 63.7
Methylmalonyl-CoA: 56.7
Propionyl-CoA: 39.8
Ethylmalonyl-CoA: 35.7
Benzoyl-CoA: 23.2
2-Methylbutyryl-CoA: 21.7
CHC-CoA: 21.5
trans-1,2-CPDA: 16.5
fatty_acid: 15.2
Acetyl-CoA: 13.1
Isobutyryl-CoA: 12.0
3-Methylbutyryl-CoA: 10.5

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

ctg58_3

Search NORINE for peptide: strict or relaxed

AMP-binding (395..795): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg58_4

Search NORINE for peptide: strict or relaxed

AMP-binding (0..399): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLmtK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

ctg58_5

Search NORINE for peptide: strict or relaxed

AMP-binding (18..421): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLmtK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

AMP-binding (1081..1480): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg58_6

Search NORINE for peptide: strict or relaxed

AMP-binding (467..867): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg58_8

Search NORINE for peptide: strict or relaxed

AMP-binding (264..669): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAIgK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

ctg58_9

Search NORINE for peptide: strict or relaxed

AMP-binding (457..855): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg58_11

Search NORINE for peptide: strict or relaxed

AMP-binding (461..862): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1525..1942): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2601..2994): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIaQLGyIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

ctg58_13

Search NORINE for peptide: strict or relaxed

AMP-binding (454..849): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

c00060_3300010.. - Region 1 - terpene

Download region GenBank file

Location: 109,295 - 130,851 nt. (total: 21,557 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00064_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 54,620 - 77,607 nt. (total: 22,988 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg64_57 - Putative Class II

allorf_062720_062905 leader / core peptide: LQDLEAWRPRPRIPYRLLLPRELLIEYSKQPRGSPLLSLWLDDRLGG - VFDCPFRWDhaFDhaKDDha
allorf_062990_063073 leader / core peptide: VVRLHGENSG - ENDhaGCIRRPHDhaDhbDhaRLGDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_062720_062905 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 1681.8 Da

Molecular weight: 1682.8 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1700.9 Da N = 1; 1718.9 Da N = 2

allorf_062990_063073 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 1795.9 Da

Molecular weight: 1796.9 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1815.0 Da N = 1; 1833.0 Da N = 2; 1851.0 Da N = 3; 1869.0 Da N = 4

c00069_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,640 nt. (total: 5,640 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5640:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg69_2

Search NORINE for peptide: strict or relaxed

AMP-binding (439..843): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

c00070_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 142,642 - 165,890 nt. (total: 23,249 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg70_123 - Putative Class II

ctg70_124 leader / core peptide: MKNDEIIRAWRDADYFFDLSDEQRALLPANPVGMIELSQDALTTVAGG - ADhbCGVDhaCCDhaNCCNDhaCADhbGGYPHCCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg70_124 - Class II: Cleavage pHMM score: -1.00; RODEO score: 0; Monoisotopic mass: 2355.8 Da; Molecular weight: 2357.7 Da; Number of bridges: 5

c00072_3300010.. - Region 1 - arylpolyene

Download region GenBank file

Location: 1 - 13,673 nt. (total: 13,673 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00081_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 651 - 80,933 nt. (total: 80,283 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 650 - 80933:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - thr - D-X) + (phe - thr - thr - leu - mal - ile) + (D-ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg81_15

Search NORINE for peptide: strict or relaxed

AMP-binding (524..929): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg81_16

Search NORINE for peptide: strict or relaxed

AMP-binding (460..850): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWtIAAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 90% (moderate)

AMP-binding (1507..1884): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2538..2915): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3569..3947): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

PKS_AT (4666..4984): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.5
Methoxymalonyl-CoA: 73.8
inactive: 68.6
Methylmalonyl-CoA: 67.6
Propionyl-CoA: 44.9
Ethylmalonyl-CoA: 41.9
Isobutyryl-CoA: 35.8
2-Methylbutyryl-CoA: 28.9
Benzoyl-CoA: 20.5
CHC-CoA: 18.6
fatty_acid: 15.6
trans-1,2-CPDA: 14.6
Acetyl-CoA: 13.7
3-Methylbutyryl-CoA: 12.8

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

AMP-binding (5671..6070): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGlTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (6730..7125): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg81_17

Search NORINE for peptide: strict or relaxed

CAL_domain (39..476): pk

minowa: NH2

Prediction, score:

NH2: 203.5
AHBA: 22.1
fatty_acid: 16.1
shikimic_acid: 7.9
Acetyl-CoA: 0.8

AMP-binding (1201..1572): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNsALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (2234..2613): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3273..3676): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVwDVGtIDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 80% (moderate)

c00082_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 40,841 - 68,057 nt. (total: 27,217 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg82_36 - Putative Class I

allorf_50585_50761 leader / core peptide: VAREKVMKKEQKKVKLSLDDLEIESFEAKVAPI - VLGGDhbADhaDhaDhaDhaILDhaCAHDhaDhaCPRGGPC

Lanthipeptide(s) for ctg82_44 - Putative Class I

allorf_50585_50761 leader / core peptide: VAREKVMKKEQKKVKLSLDDLEIESFEAKVAPI - VLGGDhbADhaDhaDhaDhaILDhaCAHDhaDhaCPRGGPC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_50585_50761 - Class I

Cleavage pHMM score: -14.00

RODEO score: 18

Monoisotopic mass: 2189.1 Da

Molecular weight: 2190.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2208.5 Da N = 1; 2226.5 Da N = 2; 2244.5 Da N = 3; 2262.5 Da N = 4; 2280.5 Da N = 5

allorf_50585_50761 - Class I

Cleavage pHMM score: -14.00

RODEO score: 18

Monoisotopic mass: 2189.1 Da

Molecular weight: 2190.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2208.5 Da N = 1; 2226.5 Da N = 2; 2244.5 Da N = 3; 2262.5 Da N = 4; 2280.5 Da N = 5

c00088_3300010.. - Region 1 - T3PKS

Download region GenBank file

Location: 4,536 - 45,597 nt. (total: 41,062 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00094_3300010.. - Region 1 - NRPS-like

Download region GenBank file

Location: 4,289 - 47,894 nt. (total: 43,606 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 4288 - 47894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg94_21

Search NORINE for peptide: strict or relaxed

AMP-binding (20..420): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsecyGGVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

c00099_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 83,010 - 93,951 nt. (total: 10,942 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it