3300010397_8 - 67 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00003_3300010.. (original name was: 3300010397.a:Ga0134124_10000348)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	bacteriocin	6,468	18,438

c00004_3300010.. (original name was: 3300010397.a:Ga0134124_10000010)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	lanthipeptide	219,329	242,568

c00005_3300010.. (original name was: 3300010397.a:Ga0134124_10000374)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS,T1PKS	1	38,941

c00008_3300010.. (original name was: 3300010397.a:Ga0134124_10000134)

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	NRPS	1	67,934

c00009_3300010.. (original name was: 3300010397.a:Ga0134124_10000007)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	hglE-KS	213,089	261,362

c00010_3300010.. (original name was: 3300010397.a:Ga0134124_10000654)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	T1PKS,NRPS	1	27,517

c00012_3300010.. (original name was: 3300010397.a:Ga0134124_10000006)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	NRPS-like	35,516	76,021
Region 12.2	NRPS	446,689	474,392

c00013_3300010.. (original name was: 3300010397.a:Ga0134124_10000018)

Region	Type	From	To
Region 13.1	NRPS	3	81,391
Region 13.2	ladderane	126,082	167,311
Region 13.3	NRPS,bacteriocin,T1PKS	173,164	243,365

c00015_3300010.. (original name was: 3300010397.a:Ga0134124_10000675)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS	1	27,173

c00018_3300010.. (original name was: 3300010397.a:Ga0134124_10000047)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	T1PKS,NRPS	23,867	89,709

c00022_3300010.. (original name was: 3300010397.a:Ga0134124_10000032)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	NRPS	152,544	202,030

c00024_3300010.. (original name was: 3300010397.a:Ga0134124_10000004)

Region	Type	From	To
Region 24.1	NRPS	151,988	205,834
Region 24.2	NRPS,T1PKS	266,608	333,396
Region 24.3	NRPS,T1PKS	466,019	496,990

c00028_3300010.. (original name was: 3300010397.a:Ga0134124_10000111)

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	bacteriocin	64,877	75,695

c00029_3300010.. (original name was: 3300010397.a:Ga0134124_10000014)

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	NRPS,T1PKS	225,885	312,750

c00031_3300010.. (original name was: 3300010397.a:Ga0134124_10000025)

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	NRPS	1	83,053

c00032_3300010.. (original name was: 3300010397.a:Ga0134124_10000034)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS,T1PKS	1	133,926
Region 32.2	NRPS-like	147,052	183,709

c00034_3300010.. (original name was: 3300010397.a:Ga0134124_10000012)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	lanthipeptide,NRPS	111,726	186,252
Region 34.2	lanthipeptide,bacteriocin	256,290	286,097

c00035_3300010.. (original name was: 3300010397.a:Ga0134124_10062881)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	1	3,145

c00037_3300010.. (original name was: 3300010397.a:Ga0134124_10000015)

Region	Type	From	To	Most similar known cluster		Similarity
Region 37.1	NRPS,T1PKS	1	275,339
Region 37.2	NRPS	282,962	310,543

c00038_3300010.. (original name was: 3300010397.a:Ga0134124_10000095)

Region	Type	From	To	Most similar known cluster		Similarity
Region 38.1	NRPS,T1PKS	4,429	85,662

c00039_3300010.. (original name was: 3300010397.a:Ga0134124_10000048)

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	NRPS,T1PKS	2	130,058

c00044_3300010.. (original name was: 3300010397.a:Ga0134124_10026230)

Region	Type	From	To	Most similar known cluster		Similarity
Region 44.1	NRPS	1	4,799

c00045_3300010.. (original name was: 3300010397.a:Ga0134124_10000013)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	NRPS	38,177	165,711
Region 45.2	T3PKS	263,935	304,984

c00046_3300010.. (original name was: 3300010397.a:Ga0134124_10000077)

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	NRPS,T1PKS	1	95,278

c00048_3300010.. (original name was: 3300010397.a:Ga0134124_10001973)

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	NRPS	1	16,506

c00049_3300010.. (original name was: 3300010397.a:Ga0134124_10000155)

Region	Type	From	To	Most similar known cluster		Similarity
Region 49.1	T1PKS,NRPS	1	63,393

c00053_3300010.. (original name was: 3300010397.a:Ga0134124_10000011)

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	NRPS	136,384	205,407
Region 53.2	NRPS,T1PKS	216,433	393,087

c00054_3300010.. (original name was: 3300010397.a:Ga0134124_10023589)

Region	Type	From	To	Most similar known cluster		Similarity
Region 54.1	NRPS	1	5,055

c00057_3300010.. (original name was: 3300010397.a:Ga0134124_10000732)

Region	Type	From	To	Most similar known cluster		Similarity
Region 57.1	NRPS	1	26,358

c00058_3300010.. (original name was: 3300010397.a:Ga0134124_10000020)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	T1PKS,NRPS	1	48,973
Region 58.2	NRPS	162,325	218,887

c00060_3300010.. (original name was: 3300010397.a:Ga0134124_10000893)

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	NRPS	1	23,944

c00061_3300010.. (original name was: 3300010397.a:Ga0134124_10017141)

Region	Type	From	To	Most similar known cluster		Similarity
Region 61.1	NRPS	1	5,905

c00062_3300010.. (original name was: 3300010397.a:Ga0134124_10000184)

Region	Type	From	To	Most similar known cluster		Similarity
Region 62.1	NRPS	1	31,157

c00068_3300010.. (original name was: 3300010397.a:Ga0134124_10000069)

Region	Type	From	To	Most similar known cluster		Similarity
Region 68.1	NRPS,T1PKS	1	102,948

c00069_3300010.. (original name was: 3300010397.a:Ga0134124_10000084)

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	NRPS-like	1	23,493
Region 69.2	NRPS	52,347	90,834

c00070_3300010.. (original name was: 3300010397.a:Ga0134124_10000064)

Region	Type	From	To	Most similar known cluster		Similarity
Region 70.1	lanthipeptide	38,538	64,097

c00071_3300010.. (original name was: 3300010397.a:Ga0134124_10000017)

Region	Type	From	To	Most similar known cluster		Similarity
Region 71.1	NRPS	17,281	82,070

c00072_3300010.. (original name was: 3300010397.a:Ga0134124_10013368)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	NRPS	1	6,647

c00073_3300010.. (original name was: 3300010397.a:Ga0134124_10000003)

Region	Type	From	To
Region 73.1	NRPS,T1PKS	59,771	132,588
Region 73.2	NRPS	216,586	292,431
Region 73.3	NRPS	313,015	460,463
Region 73.4	bacteriocin	479,847	490,752

c00074_3300010.. (original name was: 3300010397.a:Ga0134124_10005532)

Region	Type	From	To	Most similar known cluster		Similarity
Region 74.1	NRPS	1	10,155

c00075_3300010.. (original name was: 3300010397.a:Ga0134124_10000197)

Region	Type	From	To	Most similar known cluster		Similarity
Region 75.1	terpene	1	17,711

c00076_3300010.. (original name was: 3300010397.a:Ga0134124_10026625)

Region	Type	From	To	Most similar known cluster		Similarity
Region 76.1	NRPS	1	4,764

c00082_3300010.. (original name was: 3300010397.a:Ga0134124_10000038)

Region	Type	From	To	Most similar known cluster		Similarity
Region 82.1	T1PKS,NRPS,terpene	44,403	119,691

c00084_3300010.. (original name was: 3300010397.a:Ga0134124_10000092)

Region	Type	From	To	Most similar known cluster		Similarity
Region 84.1	NRPS,T1PKS	1	71,635

c00086_3300010.. (original name was: 3300010397.a:Ga0134124_10000028)

Region	Type	From	To	Most similar known cluster		Similarity
Region 86.1	NRPS	175,775	228,158

c00087_3300010.. (original name was: 3300010397.a:Ga0134124_10000125)

Region	Type	From	To	Most similar known cluster		Similarity
Region 87.1	T1PKS,NRPS	7,043	65,700

c00088_3300010.. (original name was: 3300010397.a:Ga0134124_10000089)

Region	Type	From	To	Most similar known cluster		Similarity
Region 88.1	NRPS	1	30,158

c00089_3300010.. (original name was: 3300010397.a:Ga0134124_10000119)

Region	Type	From	To	Most similar known cluster		Similarity
Region 89.1	bacteriocin	56,099	67,046

c00090_3300010.. (original name was: 3300010397.a:Ga0134124_10000022)

Region	Type	From	To	Most similar known cluster		Similarity
Region 90.1	T1PKS,lanthipeptide	54,631	101,613
Region 90.2	lanthipeptide	173,089	195,536

c00091_3300010.. (original name was: 3300010397.a:Ga0134124_10003999)

Region	Type	From	To	Most similar known cluster		Similarity
Region 91.1	NRPS	1	11,845

c00092_3300010.. (original name was: 3300010397.a:Ga0134124_10065107)

Region	Type	From	To	Most similar known cluster		Similarity
Region 92.1	NRPS	1	3,094

No secondary metabolite regions were found in these records:: c00001_3300010.. (original name was: 3300010397.a:Ga0134124_10065677); c00002_3300010.. (original name was: 3300010397.a:Ga0134124_10045637); c00006_3300010.. (original name was: 3300010397.a:Ga0134124_10000139); c00007_3300010.. (original name was: 3300010397.a:Ga0134124_10000016); c00011_3300010.. (original name was: 3300010397.a:Ga0134124_10000266); c00014_3300010.. (original name was: 3300010397.a:Ga0134124_10001836); c00016_3300010.. (original name was: 3300010397.a:Ga0134124_10000044); c00017_3300010.. (original name was: 3300010397.a:Ga0134124_10000031); c00019_3300010.. (original name was: 3300010397.a:Ga0134124_10000094); c00020_3300010.. (original name was: 3300010397.a:Ga0134124_10000024); c00021_3300010.. (original name was: 3300010397.a:Ga0134124_10000079); c00023_3300010.. (original name was: 3300010397.a:Ga0134124_10000027); c00025_3300010.. (original name was: 3300010397.a:Ga0134124_10000051); c00026_3300010.. (original name was: 3300010397.a:Ga0134124_10000050); c00027_3300010.. (original name was: 3300010397.a:Ga0134124_10061205); c00030_3300010.. (original name was: 3300010397.a:Ga0134124_10000219); c00033_3300010.. (original name was: 3300010397.a:Ga0134124_10004399); c00036_3300010.. (original name was: 3300010397.a:Ga0134124_10000209); c00040_3300010.. (original name was: 3300010397.a:Ga0134124_10000634); c00041_3300010.. (original name was: 3300010397.a:Ga0134124_10000067); c00042_3300010.. (original name was: 3300010397.a:Ga0134124_10000164); c00043_3300010.. (original name was: 3300010397.a:Ga0134124_10001029); c00047_3300010.. (original name was: 3300010397.a:Ga0134124_10000030); c00050_3300010.. (original name was: 3300010397.a:Ga0134124_10000036); c00051_3300010.. (original name was: 3300010397.a:Ga0134124_10000715); c00052_3300010.. (original name was: 3300010397.a:Ga0134124_10005839); c00055_3300010.. (original name was: 3300010397.a:Ga0134124_10000538); c00056_3300010.. (original name was: 3300010397.a:Ga0134124_10000053); c00059_3300010.. (original name was: 3300010397.a:Ga0134124_10000117); c00063_3300010.. (original name was: 3300010397.a:Ga0134124_10006739); c00064_3300010.. (original name was: 3300010397.a:Ga0134124_10000055); c00065_3300010.. (original name was: 3300010397.a:Ga0134124_10001898); c00066_3300010.. (original name was: 3300010397.a:Ga0134124_10005986); c00067_3300010.. (original name was: 3300010397.a:Ga0134124_10000166); c00077_3300010.. (original name was: 3300010397.a:Ga0134124_10000039); c00078_3300010.. (original name was: 3300010397.a:Ga0134124_10000070); c00079_3300010.. (original name was: 3300010397.a:Ga0134124_10000167); c00080_3300010.. (original name was: 3300010397.a:Ga0134124_10000264); c00081_3300010.. (original name was: 3300010397.a:Ga0134124_10000076); c00083_3300010.. (original name was: 3300010397.a:Ga0134124_10000099); c00085_3300010.. (original name was: 3300010397.a:Ga0134124_10000096)

Compact view

c00003_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 6,468 - 18,438 nt. (total: 11,971 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00004_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 219,329 - 242,568 nt. (total: 23,240 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_206 - Putative Class II

allorf_235255_235449 leader / core peptide: LGDLAAGRSQAAGG - DhaLRRNQRRRNLPERRWRRELEAHGAGPGVWEHDGGGRDhaRVNLCRRCIRDhaL
allorf_224316_224489 leader / core peptide: MALGGRFSYPPSYPPSYPTSHPTNHPTSHPTSRAAVEAAGREGG - NGKRDhbDQEDhbRCDhaA
allorf_235099_235284 leader / core peptide: LGSTSSEVTQAPGG - PAGCQAGGGGAPACDhaPDRNVKADhaDhbDhaARRRDRFFIWLIDhaLMARVLPQDha
allorf_237415_237567 leader / core peptide: VDRRTGSSQGG - ADhaLVWGDDhaCQVGADhaNNPMDhbAHLGAVDhbDLPPVDVGFADDhbL

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_235255_235449 - Class II

Cleavage pHMM score: -3.50

RODEO score: 0

Monoisotopic mass: 5919.2 Da

Molecular weight: 5922.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 5940.7 Da N = 1

allorf_224316_224489 - Class II

Cleavage pHMM score: -4.00

RODEO score: 0

Monoisotopic mass: 1410.7 Da

Molecular weight: 1411.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1429.5 Da N = 1; 1447.5 Da N = 2

allorf_235099_235284 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 4862.5 Da

Molecular weight: 4865.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4883.6 Da N = 1; 4901.6 Da N = 2; 4919.6 Da N = 3; 4937.6 Da N = 4

allorf_237415_237567 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 3816.9 Da

Molecular weight: 3819.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3837.2 Da N = 1; 3855.3 Da N = 2; 3873.3 Da N = 3; 3891.3 Da N = 4; 3909.3 Da N = 5

c00005_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 38,941 nt. (total: 38,941 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - val - gly) + (mal - ala - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_1

Search NORINE for peptide: strict or relaxed

AMP-binding (511..806): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAedVA---K
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

ctg5_17

Search NORINE for peptide: strict or relaxed

AMP-binding (500..927): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVpHlSLVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (1618..2088): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGacFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (2768..3215): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

ctg5_23

Search NORINE for peptide: strict or relaxed

PKS_AT (538..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.8
inactive: 84.8
Methoxymalonyl-CoA: 79.4
Methylmalonyl-CoA: 55.5
Isobutyryl-CoA: 38.7
Propionyl-CoA: 32.9
CHC-CoA: 24.4
Benzoyl-CoA: 21.3
fatty_acid: 18.2
2-Methylbutyryl-CoA: 17.5
Ethylmalonyl-CoA: 17.2
Acetyl-CoA: 10.0
3-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 6.8

AMP-binding (1548..1946): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2633..3050): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00008_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 67,934 nt. (total: 67,934 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 67934:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - X) + (ser - ile - glu) + (ala - ala - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg8_1

Search NORINE for peptide: strict or relaxed

AMP-binding (194..601): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (1264..1686): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2357..2741): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg8_22

Search NORINE for peptide: strict or relaxed

AMP-binding (11..399): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgFyVAAVlK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg8_25

Search NORINE for peptide: strict or relaxed

AMP-binding (517..927): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1609..2009): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAwFLGvTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (3105..3500): glu

NRPSPredictor2: glu

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

ctg8_38

Search NORINE for peptide: strict or relaxed

AMP-binding (490..889): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAyfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1547..1963): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtESIGSivK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 70% (weak)

AMP-binding (2640..3037): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAyfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

c00009_3300010.. - Region 1 - hglE-KS

Download region GenBank file

Location: 213,089 - 261,362 nt. (total: 48,274 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00010_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 27,517 nt. (total: 27,517 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27517:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_2

Search NORINE for peptide: strict or relaxed

AMP-binding (1278..1679): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg10_4

PKS_AT (572..867): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 62.5%; Malonyl-CoA: 58.3%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 93.8
Methoxymalonyl-CoA: 77.7
Isobutyryl-CoA: 71.4
Benzoyl-CoA: 64.9
Ethylmalonyl-CoA: 63.6
Propionyl-CoA: 61.6
Malonyl-CoA: 51.9
2-Methylbutyryl-CoA: 51.6
trans-1,2-CPDA: 41.9
Acetyl-CoA: 33.8
3-Methylbutyryl-CoA: 28.3
CHC-CoA: 26.3
fatty_acid: 22.6
inactive: 19.3

PKS_AT (1036..1323): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 134.8
Malonyl-CoA: 124.7
Methoxymalonyl-CoA: 109.9
Isobutyryl-CoA: 101.4
Ethylmalonyl-CoA: 95.5
Propionyl-CoA: 77.2
2-Methylbutyryl-CoA: 69.8
Benzoyl-CoA: 59.8
inactive: 56.0
CHC-CoA: 51.8
Acetyl-CoA: 49.6
3-Methylbutyryl-CoA: 45.7
fatty_acid: 43.1
trans-1,2-CPDA: 42.9

ctg10_5

Search NORINE for peptide: strict or relaxed

AMP-binding (555..949): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEniGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

c00012_3300010.. - Region 1 - NRPS-like

Download region GenBank file

Location: 35,516 - 76,021 nt. (total: 40,506 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00012_3300010.. - Region 2 - NRPS

Download region GenBank file

Location: 446,689 - 474,392 nt. (total: 27,704 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 446688 - 474392:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg12_347

Search NORINE for peptide: strict or relaxed

AMP-binding (72..462): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1134..1558): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00013_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 3 - 81,391 nt. (total: 81,389 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 2 - 81391:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X - ala - asp - val - ala) + (gly - thr - ile - X - X - X - D-X - gly - X - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_1

Search NORINE for peptide: strict or relaxed

CAL_domain (42..471): pk

minowa: NH2

Prediction, score:

NH2: 193.9
fatty_acid: 23.8
AHBA: 5.7
Acetyl-CoA: 5.6
shikimic_acid: 0.0

AMP-binding (1140..1547): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2195..2587): X

NRPSPredictor2: ser, thr, dhpg, hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGdfGmIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (3244..3686): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4351..4749): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (5414..5826): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (6494..6892): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg13_6

Search NORINE for peptide: strict or relaxed

CAL_domain (39..454): pk

minowa: NH2

Prediction, score:

NH2: 182.4
fatty_acid: 22.8
AHBA: 15.5
shikimic_acid: -0.8
Acetyl-CoA: -1.7

AMP-binding (1123..1516): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2176..2568): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3216..3613): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (4260..4668): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHLGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

AMP-binding (5315..5718): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGyqGK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

AMP-binding (6366..6764): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (7965..8360): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (9469..9846): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (10492..10901): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (11559..11947): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwLIGAVaK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

c00013_3300010.. - Region 2 - ladderane

Download region GenBank file

Location: 126,082 - 167,311 nt. (total: 41,230 nt) Show pHMM detection rules used

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00013_3300010.. - Region 3 - NRPS,T1PKS,bacteriocin

Download region GenBank file

Location: 173,164 - 243,365 nt. (total: 70,202 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 173163 - 243365:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal) + (X - val - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 173163 - 233499:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal) + (X - val - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 193511 - 243365:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal) + (X - val - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_112

Search NORINE for peptide: strict or relaxed

AMP-binding (494..899): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DllFLGsVFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

AMP-binding (1594..2005): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvENiGaItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

ctg13_115

Search NORINE for peptide: strict or relaxed

AMP-binding (7..384): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLLvK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

AMP-binding (1016..1464): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (2138..2587): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvWFyGaVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg13_116

PKS_AT (556..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 157.1
inactive: 83.8
Methoxymalonyl-CoA: 76.9
Methylmalonyl-CoA: 68.0
Propionyl-CoA: 57.2
CHC-CoA: 47.1
Ethylmalonyl-CoA: 42.2
Isobutyryl-CoA: 33.9
2-Methylbutyryl-CoA: 33.4
fatty_acid: 32.6
Benzoyl-CoA: 27.0
Acetyl-CoA: 19.0
trans-1,2-CPDA: 17.4
3-Methylbutyryl-CoA: 7.3

ctg13_117

PKS_AT (533..802): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 145.9
inactive: 95.1
Methoxymalonyl-CoA: 69.6
Methylmalonyl-CoA: 59.6
Ethylmalonyl-CoA: 46.2
Propionyl-CoA: 44.5
2-Methylbutyryl-CoA: 26.0
CHC-CoA: 24.2
Acetyl-CoA: 23.3
trans-1,2-CPDA: 19.0
Benzoyl-CoA: 14.4
Isobutyryl-CoA: 14.2
fatty_acid: 11.3
3-Methylbutyryl-CoA: 10.1

c00015_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 27,173 nt. (total: 27,173 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27173:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - D-thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_14

Search NORINE for peptide: strict or relaxed

AMP-binding (871..1155): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1826..2236): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00018_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 23,867 - 89,709 nt. (total: 65,843 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 23866 - 89709:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - X - leu) + (ile - X - ala) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg18_34

PKS_AT (534..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 115.2
inactive: 78.6
Methoxymalonyl-CoA: 60.8
Methylmalonyl-CoA: 52.5
Propionyl-CoA: 45.7
Ethylmalonyl-CoA: 33.5
2-Methylbutyryl-CoA: 27.7
Isobutyryl-CoA: 24.0
Acetyl-CoA: 21.4
Benzoyl-CoA: 19.5
CHC-CoA: 18.1
trans-1,2-CPDA: 12.7
3-Methylbutyryl-CoA: 10.4
fatty_acid: 9.4

ctg18_35

Search NORINE for peptide: strict or relaxed

AMP-binding (0..323): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1030..1425): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgfWLGGTgK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

AMP-binding (2093..2553): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg18_36

Search NORINE for peptide: strict or relaxed

CAL_domain (42..476): pk

minowa: NH2

Prediction, score:

NH2: 235.5
fatty_acid: 28.3
AHBA: 9.9
shikimic_acid: 7.9
Acetyl-CoA: 3.2

AMP-binding (1141..1523): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2189..2584): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DaWSVGtIsK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 70% (weak)

AMP-binding (3303..3701): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvFLGCtFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

c00022_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 152,544 - 202,030 nt. (total: 49,487 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 152543 - 202030:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - pro - X) + (val - asn - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg22_131

Search NORINE for peptide: strict or relaxed

AMP-binding (512..960): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1655..2083): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (2747..3199): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArsLsqMtK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

ctg22_137

Search NORINE for peptide: strict or relaxed

AMP-binding (810..1211): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1895..2297): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DgTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (2973..3373): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00024_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 151,988 - 205,834 nt. (total: 53,847 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 151987 - 205834:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg24_143

Search NORINE for peptide: strict or relaxed

AMP-binding (512..971): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1639..2067): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeALsGthK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (2743..3157): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdEK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (4138..4534): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRnvaVraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

c00024_3300010.. - Region 2 - NRPS,T1PKS

Download region GenBank file

Location: 266,608 - 333,396 nt. (total: 66,789 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 266607 - 333396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile - ala) + (ohmal) + (D-X) + (thr - X - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg24_223

Search NORINE for peptide: strict or relaxed

AMP-binding (516..935): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1604..1989): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DspdIsEVwK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 50% (weak)

PKS_AT (2695..2980): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 162.3
inactive: 104.8
Methoxymalonyl-CoA: 76.4
Methylmalonyl-CoA: 59.9
Propionyl-CoA: 38.7
Ethylmalonyl-CoA: 35.7
Isobutyryl-CoA: 33.8
2-Methylbutyryl-CoA: 29.6
CHC-CoA: 25.6
Acetyl-CoA: 22.3
Benzoyl-CoA: 20.5
trans-1,2-CPDA: 17.2
3-Methylbutyryl-CoA: 13.7
fatty_acid: 10.4

ctg24_224

Search NORINE for peptide: strict or relaxed

AMP-binding (538..915): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAliaGLIyK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

ctg24_225

PKS_AT (540..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 118.2
inactive: 85.6
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 48.3
Propionyl-CoA: 26.9
Ethylmalonyl-CoA: 26.7
Isobutyryl-CoA: 22.5
Benzoyl-CoA: 17.7
CHC-CoA: 8.7
2-Methylbutyryl-CoA: 3.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Acetyl-CoA: -2.4
3-Methylbutyryl-CoA: -2.7

ctg24_226

Search NORINE for peptide: strict or relaxed

AMP-binding (473..870): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFlGITFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1617..2023): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00024_3300010.. - Region 3 - NRPS,T1PKS

Download region GenBank file

Location: 466,019 - 496,990 nt. (total: 30,972 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 466018 - 496990:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg24_362

Search NORINE for peptide: strict or relaxed

PKS_AT (568..871): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.4
inactive: 83.9
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 42.9
Propionyl-CoA: 33.5
2-Methylbutyryl-CoA: 22.6
Ethylmalonyl-CoA: 19.0
Isobutyryl-CoA: 18.0
trans-1,2-CPDA: 14.4
Benzoyl-CoA: 13.5
CHC-CoA: 12.9
Acetyl-CoA: 10.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1526..1944): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DmYHLGLmdK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg24_363

Search NORINE for peptide: strict or relaxed

AMP-binding (511..920): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

c00028_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 64,877 - 75,695 nt. (total: 10,819 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00029_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 225,885 - 312,750 nt. (total: 86,866 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 225884 - 312750:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile - ala - X) + (X) + (mal - pro - ser) + (ala - val - ala - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg29_203

Search NORINE for peptide: strict or relaxed

CAL_domain (40..468): pk

minowa: NH2

Prediction, score:

NH2: 179.4
fatty_acid: 27.3
AHBA: 20.9
Acetyl-CoA: 4.0
shikimic_acid: 0.0

AMP-binding (1124..1521): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGmFLGVVlK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (2184..2568): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (3237..3650): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvyFLGgVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg29_204

Search NORINE for peptide: strict or relaxed

A-OX (536..1248): X

AMP-binding (1101..1342): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ----LGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

ctg29_210

Search NORINE for peptide: strict or relaxed

PKS_AT (561..931): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.5
inactive: 80.7
Methoxymalonyl-CoA: 68.1
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 34.2
Isobutyryl-CoA: 32.2
fatty_acid: 25.3
Benzoyl-CoA: 19.2
Acetyl-CoA: 10.5
CHC-CoA: 10.2
2-Methylbutyryl-CoA: 9.7
Ethylmalonyl-CoA: 9.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1600..1988): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAHVlK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (2677..3065): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHiSLIEK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

ctg29_211

Search NORINE for peptide: strict or relaxed

CAL_domain (39..480): pk

minowa: NH2

Prediction, score:

NH2: 174.9
AHBA: 34.8
shikimic_acid: 10.3
Acetyl-CoA: 4.9
fatty_acid: 0.0

AMP-binding (1148..1522): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2177..2559): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (3244..3612): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4268..4669): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00031_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 83,053 nt. (total: 83,053 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 83053:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - ile - X - lys-b - ala - gln) + (cys - X - X - thr - ser - thr - thr - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg31_10

Search NORINE for peptide: strict or relaxed

AMP-binding (855..1136): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1804..2205): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArsLsqMtK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

AMP-binding (2878..3274): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAlTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 90% (moderate)

AMP-binding (3942..4348): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5017..5411): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (6101..6503): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (7168..7570): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (8253..8657): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

ctg31_12

Search NORINE for peptide: strict or relaxed

AMP-binding (491..895): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAYfmGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1573..1973): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DALFmGLtlK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

AMP-binding (2663..3090): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAveMGsVvK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (3759..4178): lys-b

NRPSPredictor2: lys-b

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEsVGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 80% (moderate)

AMP-binding (4844..5251): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (5930..6325): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

c00032_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 133,926 nt. (total: 133,926 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 133926:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - asp - val - ala - X - ser - ser - D-X) + (D-ala - D-tyr) + (D-X - X - ohmal) + (D-X - D-ile - X - ohmal) + (D-X - D-X - D-X - tyr - val - X - X) + (D-X - D-val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_1

Search NORINE for peptide: strict or relaxed

AMP-binding (477..876): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (1982..2386): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg32_4

Search NORINE for peptide: strict or relaxed

AMP-binding (480..874): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (2008..2408): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (3533..3929): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (5073..5444): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (6112..6515): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (7183..7572): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (8241..8630): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTmAlIwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg32_5

Search NORINE for peptide: strict or relaxed

AMP-binding (479..879): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (2011..2412): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (3552..3951): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

PKS_AT (4692..5010): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 110.7
inactive: 54.9
Methoxymalonyl-CoA: 49.6
Methylmalonyl-CoA: 34.2
Isobutyryl-CoA: 29.7
Propionyl-CoA: 22.6
fatty_acid: 7.1
Benzoyl-CoA: 6.6
Ethylmalonyl-CoA: 6.1
3-Methylbutyryl-CoA: 2.8
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -2.1

ctg32_6

Search NORINE for peptide: strict or relaxed

AMP-binding (453..838): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (1953..2331): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

PKS_AT (3061..3368): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 137.9
inactive: 74.8
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 49.8
Propionyl-CoA: 42.8
Isobutyryl-CoA: 18.3
CHC-CoA: 18.3
fatty_acid: 16.5
2-Methylbutyryl-CoA: 12.6
Acetyl-CoA: 6.8
Benzoyl-CoA: 6.2
Ethylmalonyl-CoA: 4.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg32_7

Search NORINE for peptide: strict or relaxed

AMP-binding (493..889): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2010..2402): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg32_9

Search NORINE for peptide: strict or relaxed

CAL_domain (38..481): pk

minowa: NH2

Prediction, score:

NH2: 222.9
fatty_acid: 19.8
shikimic_acid: 5.4
AHBA: 5.1
Acetyl-CoA: -1.0

AMP-binding (1171..1569): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2233..2639): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3305..3708): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (4382..4791): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (5455..5857): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNtALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (6533..6941): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenIGAVtK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (7618..8022): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (9022..9420): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (10438..10845): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

c00032_3300010.. - Region 2 - NRPS-like

Download region GenBank file

Location: 147,052 - 183,709 nt. (total: 36,658 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 147051 - 183709:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_55

Search NORINE for peptide: strict or relaxed

AMP-binding (8..386): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DsecyGGVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

c00034_3300010.. - Region 1 - NRPS,lanthipeptide

Download region GenBank file

Location: 111,726 - 186,252 nt. (total: 74,527 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 111725 - 186252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X - gln)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 130423 - 186252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X - gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_135

Search NORINE for peptide: strict or relaxed

AMP-binding (490..911): X

NRPSPredictor2: asp, asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DakNLGLaNK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (1600..2004): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGaTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

ctg34_136

Search NORINE for peptide: strict or relaxed

AMP-binding (534..943): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKnIGmdtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (1630..2030): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

c00034_3300010.. - Region 2 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 256,290 - 286,097 nt. (total: 29,808 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00035_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,145 nt. (total: 3,145 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3145:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg35_1

Search NORINE for peptide: strict or relaxed

AMP-binding (242..643): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00037_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 275,339 nt. (total: 275,339 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 275339:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (ala - thr) + (mal - gly - val - thr - mal) + (asp - ala - ser - tyr) + (D-X) + (thr - ohmal) + (glu - D-X) + (ser - ser) + (X) + (cys - X - ala - ohmal - pro - X - pro - X - asn - val - pro) + (ser - mal - asn - ala - leu) + (ohmal) + (mal) + (ccmal) + (X) + (leu - leu - X - X - mal - gly - cys) + (ccmal - gly) + (ohmal - X - thr - mal - pro - ala - mal - pro - glu) + (ser - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg37_6

Search NORINE for peptide: strict or relaxed

CAL_domain (38..483): pk

minowa: NH2

Prediction, score:

NH2: 199.7
AHBA: 22.1
fatty_acid: 8.2
shikimic_acid: 7.3
Acetyl-CoA: -1.9

AMP-binding (1193..1604): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg37_7

Search NORINE for peptide: strict or relaxed

AMP-binding (1280..1681): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2344..2750): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg37_8

Search NORINE for peptide: strict or relaxed

PKS_AT (1017..1333): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 124.6
Methoxymalonyl-CoA: 81.7
Methylmalonyl-CoA: 66.7
inactive: 61.7
Isobutyryl-CoA: 46.0
Propionyl-CoA: 43.8
Ethylmalonyl-CoA: 39.4
2-Methylbutyryl-CoA: 26.0
3-Methylbutyryl-CoA: 21.7
CHC-CoA: 20.4
Benzoyl-CoA: 18.9
trans-1,2-CPDA: 15.2
Acetyl-CoA: 12.9
fatty_acid: 10.8

AMP-binding (1992..2374): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (3040..3445): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (4109..4525): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

PKS_AT (5243..5534): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 157.7
inactive: 80.7
Methoxymalonyl-CoA: 56.4
Methylmalonyl-CoA: 41.9
Propionyl-CoA: 34.4
Ethylmalonyl-CoA: 29.8
Isobutyryl-CoA: 22.3
CHC-CoA: 21.5
2-Methylbutyryl-CoA: 18.9
Acetyl-CoA: 16.5
Benzoyl-CoA: 13.5
fatty_acid: 10.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg37_10

Search NORINE for peptide: strict or relaxed

AMP-binding (474..879): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1552..1954): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNsALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (2625..3025): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3693..4107): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg37_11

Search NORINE for peptide: strict or relaxed

AMP-binding (170..570): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg37_12

Search NORINE for peptide: strict or relaxed

AMP-binding (476..882): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

PKS_AT (1604..1898): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 152.9
inactive: 78.2
Methoxymalonyl-CoA: 72.5
Methylmalonyl-CoA: 59.7
Propionyl-CoA: 41.8
2-Methylbutyryl-CoA: 27.9
CHC-CoA: 26.6
Ethylmalonyl-CoA: 24.9
Acetyl-CoA: 17.8
Isobutyryl-CoA: 17.7
fatty_acid: 10.1
trans-1,2-CPDA: 9.8
Benzoyl-CoA: 7.4
3-Methylbutyryl-CoA: 5.4

ctg37_13

Search NORINE for peptide: strict or relaxed

AMP-binding (515..923): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAlDLGsVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (1587..1992): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlDLGsVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg37_14

Search NORINE for peptide: strict or relaxed

AMP-binding (470..871): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1540..1938): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHcSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

ctg37_15

Search NORINE for peptide: strict or relaxed

AMP-binding (553..922): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFysLscAaK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 50% (weak)

ctg37_20

Search NORINE for peptide: strict or relaxed

AMP-binding (844..1131): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1811..2193): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (2871..3265): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

PKS_AT (3999..4325): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.8
inactive: 68.1
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 53.7
Propionyl-CoA: 35.3
Isobutyryl-CoA: 32.9
Benzoyl-CoA: 23.8
fatty_acid: 19.7
Ethylmalonyl-CoA: 18.5
CHC-CoA: 15.6
2-Methylbutyryl-CoA: 14.2
3-Methylbutyryl-CoA: 10.1
trans-1,2-CPDA: 2.6
Acetyl-CoA: 0.0

AMP-binding (5488..5890): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (6556..6941): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwLIGAVvK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (7593..7991): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (8654..9059): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvyraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (9726..10119): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (10778..11179): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (11855..12255): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

ctg37_23

Search NORINE for peptide: strict or relaxed

AMP-binding (518..918): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

PKS_AT (1649..1947): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 163.0
inactive: 95.4
Methoxymalonyl-CoA: 55.4
Methylmalonyl-CoA: 51.2
Propionyl-CoA: 41.3
2-Methylbutyryl-CoA: 29.7
Benzoyl-CoA: 26.3
Ethylmalonyl-CoA: 25.2
fatty_acid: 23.9
CHC-CoA: 22.0
Isobutyryl-CoA: 19.8
Acetyl-CoA: 14.8
trans-1,2-CPDA: 8.9
3-Methylbutyryl-CoA: 0.0

AMP-binding (2615..3015): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3679..4079): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (4747..5141): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

ctg37_24

PKS_AT (536..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 161.9
inactive: 83.5
Methoxymalonyl-CoA: 68.7
Methylmalonyl-CoA: 52.9
Ethylmalonyl-CoA: 36.4
Propionyl-CoA: 32.1
2-Methylbutyryl-CoA: 25.1
CHC-CoA: 22.7
Isobutyryl-CoA: 21.0
Acetyl-CoA: 20.3
trans-1,2-CPDA: 13.2
Benzoyl-CoA: 12.4
fatty_acid: 8.8
3-Methylbutyryl-CoA: 0.0

ctg37_25

PKS_AT (534..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 165.6
Methoxymalonyl-CoA: 82.0
Methylmalonyl-CoA: 74.4
inactive: 60.3
Ethylmalonyl-CoA: 50.4
Propionyl-CoA: 45.0
2-Methylbutyryl-CoA: 32.6
fatty_acid: 30.1
CHC-CoA: 29.8
Isobutyryl-CoA: 25.8
Acetyl-CoA: 23.7
Benzoyl-CoA: 23.6
trans-1,2-CPDA: 16.6
3-Methylbutyryl-CoA: 0.0

ctg37_26

PKS_AT (535..834): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 143.4
inactive: 73.7
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 60.9
Ethylmalonyl-CoA: 33.0
Propionyl-CoA: 26.3
Isobutyryl-CoA: 17.3
fatty_acid: 13.8
Benzoyl-CoA: 12.3
Acetyl-CoA: 11.9
trans-1,2-CPDA: 8.4
2-Methylbutyryl-CoA: 7.4
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg37_27

Search NORINE for peptide: strict or relaxed

CAL_domain (39..483): pk

minowa: NH2

Prediction, score:

NH2: 218.8
fatty_acid: 22.4
AHBA: 10.1
Acetyl-CoA: 0.3
shikimic_acid: 0.0

A-OX (1178..1952): X

ctg37_32

Search NORINE for peptide: strict or relaxed

CAL_domain (49..476): pk

minowa: NH2

Prediction, score:

NH2: 209.4
shikimic_acid: 9.4
Acetyl-CoA: 7.5
AHBA: 0.6
fatty_acid: -1.7

AMP-binding (1154..1544): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwFFGLViK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

AMP-binding (2212..2613): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (3271..3652): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGgTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (4322..4735): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvyraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

PKS_AT (5475..5786): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.7
inactive: 105.3
Methoxymalonyl-CoA: 81.3
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 45.4
CHC-CoA: 32.3
Isobutyryl-CoA: 31.4
Ethylmalonyl-CoA: 25.9
fatty_acid: 22.2
Benzoyl-CoA: 18.9
2-Methylbutyryl-CoA: 18.7
Acetyl-CoA: 15.3
trans-1,2-CPDA: 14.6
3-Methylbutyryl-CoA: 0.0

AMP-binding (6449..6844): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (7512..7920): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

ctg37_33

Search NORINE for peptide: strict or relaxed

PKS_AT (538..828): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 163.4
inactive: 106.2
Methoxymalonyl-CoA: 72.8
Methylmalonyl-CoA: 58.4
Propionyl-CoA: 42.5
Isobutyryl-CoA: 28.8
CHC-CoA: 23.6
Ethylmalonyl-CoA: 23.0
2-Methylbutyryl-CoA: 22.5
Acetyl-CoA: 19.8
Benzoyl-CoA: 12.5
trans-1,2-CPDA: 9.8
3-Methylbutyryl-CoA: 9.4
fatty_acid: 0.0

AMP-binding (2266..2658): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg37_34

Search NORINE for peptide: strict or relaxed

PKS_AT (541..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 142.0
inactive: 85.2
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 52.4
Isobutyryl-CoA: 36.6
Ethylmalonyl-CoA: 28.1
Propionyl-CoA: 27.0
Benzoyl-CoA: 17.6
2-Methylbutyryl-CoA: 17.3
3-Methylbutyryl-CoA: 11.7
CHC-CoA: 8.6
Acetyl-CoA: 6.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

AMP-binding (1995..2408): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (3078..3497): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSiGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 90% (moderate)

PKS_AT (4225..4511): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.8
inactive: 89.4
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 51.7
Isobutyryl-CoA: 38.9
Propionyl-CoA: 31.0
Ethylmalonyl-CoA: 31.0
2-Methylbutyryl-CoA: 22.2
Benzoyl-CoA: 20.8
CHC-CoA: 19.5
Acetyl-CoA: 19.0
fatty_acid: 13.5
trans-1,2-CPDA: 9.2
3-Methylbutyryl-CoA: 0.0

AMP-binding (5162..5574): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFrAdVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (6248..6650): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

PKS_AT (7377..7691): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 137.5
Methoxymalonyl-CoA: 79.5
inactive: 67.3
Methylmalonyl-CoA: 65.5
Propionyl-CoA: 46.5
Ethylmalonyl-CoA: 41.8
Isobutyryl-CoA: 34.2
2-Methylbutyryl-CoA: 23.1
Benzoyl-CoA: 21.0
trans-1,2-CPDA: 17.7
fatty_acid: 17.1
CHC-CoA: 16.9
Acetyl-CoA: 13.6
3-Methylbutyryl-CoA: 11.3

AMP-binding (8358..8758): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (9425..9839): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DAlDLGsVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

ctg37_35

Search NORINE for peptide: strict or relaxed

AMP-binding (515..919): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1579..1994): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00037_3300010.. - Region 2 - NRPS

Download region GenBank file

Location: 282,962 - 310,543 nt. (total: 27,582 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 282961 - 310543:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (lys - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg37_81

Search NORINE for peptide: strict or relaxed

AMP-binding (729..1122): lys

NRPSPredictor2: lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: lys

Stachelhaus prediction details:

Stachelhaus sequence:: DAEctGcVnK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (1811..2254): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

c00038_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 4,429 - 85,662 nt. (total: 81,234 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 4428 - 85662:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - val - X - ala - X) + (ohmal) + (X - val) + (X) + (X) + (asp) + (mal - pro) + (X - X) + (mal - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg38_25

Search NORINE for peptide: strict or relaxed

CAL_domain (181..508): pk

minowa: NH2

Prediction, score:

NH2: 184.2
Acetyl-CoA: 40.5
fatty_acid: 24.3
AHBA: 13.1
shikimic_acid: 0.0

AMP-binding (1213..1621): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2282..2677): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGaTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (3361..3777): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeDlGgItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (4459..4859): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (5549..5961): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeqfGAVaK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

ctg38_26

PKS_AT (545..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.3
inactive: 89.2
Methoxymalonyl-CoA: 74.0
Methylmalonyl-CoA: 51.6
Ethylmalonyl-CoA: 33.6
Isobutyryl-CoA: 22.7
Propionyl-CoA: 17.1
fatty_acid: 13.8
CHC-CoA: 13.6
Benzoyl-CoA: 12.6
2-Methylbutyryl-CoA: 12.0
Acetyl-CoA: 9.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg38_27

Search NORINE for peptide: strict or relaxed

AMP-binding (516..922): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIfQs-LVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (1592..1987): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg38_28

Search NORINE for peptide: strict or relaxed

AMP-binding (523..927): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgWFcGlVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg38_29

Search NORINE for peptide: strict or relaxed

AMP-binding (515..908): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALhIGdvFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

ctg38_30

Search NORINE for peptide: strict or relaxed

AMP-binding (510..914): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg38_32

Search NORINE for peptide: strict or relaxed

PKS_AT (542..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.1
inactive: 68.6
Methoxymalonyl-CoA: 67.0
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 30.6
Ethylmalonyl-CoA: 29.3
CHC-CoA: 23.6
Benzoyl-CoA: 21.4
fatty_acid: 21.3
Isobutyryl-CoA: 20.5
Acetyl-CoA: 16.6
trans-1,2-CPDA: 16.5
2-Methylbutyryl-CoA: 15.7
3-Methylbutyryl-CoA: 13.0

AMP-binding (1527..1920): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVlFtAlVIK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

ctg38_33

Search NORINE for peptide: strict or relaxed

AMP-binding (519..909): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHLGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 80% (moderate)

AMP-binding (1571..1995): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHlvlraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

ctg38_34

Search NORINE for peptide: strict or relaxed

PKS_AT (535..877): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; 2-Rhyd-Malonyl-CoA: 62.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 121.3
inactive: 59.7
Methoxymalonyl-CoA: 56.3
Methylmalonyl-CoA: 31.6
Propionyl-CoA: 25.6
fatty_acid: 24.5
CHC-CoA: 18.3
Benzoyl-CoA: 12.6
trans-1,2-CPDA: 12.2
2-Methylbutyryl-CoA: 12.2
Isobutyryl-CoA: 11.3
3-Methylbutyryl-CoA: 10.0
Ethylmalonyl-CoA: 8.5
Acetyl-CoA: 0.0

AMP-binding (1591..1978): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

c00039_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 2 - 130,058 nt. (total: 130,057 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 1 - 130058:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln - X - ala - X) + (ala - thr) + (cys - ala - X - X - thr - ala - asn - asn) + (gly - X - D-X - leu - ile) + (X - ile) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 1 - 97298:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln - X - ala - X) + (ala - thr) + (cys - ala - X - X - thr - ala - asn - asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 77649 - 130058:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - X - D-X - leu - ile) + (X - ile) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg39_10

Search NORINE for peptide: strict or relaxed

AMP-binding (423..815): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLvqK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

AMP-binding (1477..1867): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGylTGdcfK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

AMP-binding (2542..2966): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3622..4027): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlIsGGTlK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg39_17

Search NORINE for peptide: strict or relaxed

CAL_domain (44..459): pk

minowa: NH2

Prediction, score:

NH2: 26.0
fatty_acid: 20.5
AHBA: 20.5
shikimic_acid: 10.6
Acetyl-CoA: -4.0

AMP-binding (1697..2115): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DFfhhGgIHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 60% (weak)

AMP-binding (2803..3199): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg39_19

Search NORINE for peptide: strict or relaxed

AMP-binding (834..1120): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1791..2199): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (2374..2776): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (4079..4485): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (5160..5559): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (6236..6643): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (7310..7710): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (8383..8784): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DgTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (9449..9855): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DgTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

ctg39_32

Search NORINE for peptide: strict or relaxed

CAL_domain (50..473): pk

minowa: NH2

Prediction, score:

NH2: 191.3
fatty_acid: 32.4
AHBA: 22.6
Acetyl-CoA: 5.2
shikimic_acid: 1.0

AMP-binding (1165..1573): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2258..2651): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (3312..3704): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (4827..5224): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (5884..6280): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg39_33

Search NORINE for peptide: strict or relaxed

AMP-binding (117..525): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgWsLGhVlK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (1201..1602): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg39_34

PKS_AT (538..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.4
inactive: 75.5
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 57.7
Propionyl-CoA: 38.2
Isobutyryl-CoA: 36.7
2-Methylbutyryl-CoA: 27.7
Benzoyl-CoA: 21.4
CHC-CoA: 18.2
fatty_acid: 16.6
3-Methylbutyryl-CoA: 7.9
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
Ethylmalonyl-CoA: -2.2

c00044_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,799 nt. (total: 4,799 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4799:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg44_1

Search NORINE for peptide: strict or relaxed

AMP-binding (3..276): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00045_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 38,177 - 165,711 nt. (total: 127,535 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 38176 - 165711:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - thr - ala - D-cys) + (val - ala - asp) + (cys - X - X - ala - X - ala - pro - ala - ala - X - ser - ser - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg45_63

Search NORINE for peptide: strict or relaxed

AMP-binding (838..1126): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdlSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

AMP-binding (1794..2177): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DveeLGVVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (2859..3272): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVlK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 90% (moderate)

AMP-binding (3948..4340): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (4520..4915): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (6232..6632): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (7302..7704): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (8387..8789): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (9476..9883): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (10544..10953): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGgINK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (11614..12073): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvyraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (12738..13133): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (13804..14207): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (15226..15615): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg45_79

Search NORINE for peptide: strict or relaxed

AMP-binding (465..866): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGavFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1530..2003): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2674..3071): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgKDLGlVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

ctg45_80

Search NORINE for peptide: strict or relaxed

AMP-binding (493..911): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNaALvYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

AMP-binding (1561..2071): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2731..3139): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (3827..4208): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

c00045_3300010.. - Region 2 - T3PKS

Download region GenBank file

Location: 263,935 - 304,984 nt. (total: 41,050 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00046_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 95,278 nt. (total: 95,278 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 95278:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - X - gly) + (ccmal) + (phe) + (ohmal) + (cys - cys) + (gly - thr - ser - gln - pro - gln) + (gly - thr - X - X - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg46_1

Search NORINE for peptide: strict or relaxed

AMP-binding (826..1112): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1777..2208): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvyraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (2892..3289): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg46_13

CAL_domain (52..500): pk

minowa: NH2

Prediction, score:

NH2: 164.3
Acetyl-CoA: 63.5
fatty_acid: 4.5
shikimic_acid: 0.0
AHBA: 0.0

ctg46_14

PKS_AT (560..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.4
inactive: 123.8
Methoxymalonyl-CoA: 80.5
Methylmalonyl-CoA: 73.0
Isobutyryl-CoA: 36.8
Ethylmalonyl-CoA: 36.3
Propionyl-CoA: 31.6
2-Methylbutyryl-CoA: 23.4
trans-1,2-CPDA: 22.7
CHC-CoA: 21.8
Benzoyl-CoA: 20.9
3-Methylbutyryl-CoA: 19.8
fatty_acid: 16.3
Acetyl-CoA: 14.9

ctg46_16

Search NORINE for peptide: strict or relaxed

AMP-binding (482..873): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTVAAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 100% (strong)

ctg46_17

PKS_AT (548..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 142.2
inactive: 71.3
Methoxymalonyl-CoA: 70.1
Methylmalonyl-CoA: 65.8
Ethylmalonyl-CoA: 59.8
Propionyl-CoA: 38.2
2-Methylbutyryl-CoA: 32.9
trans-1,2-CPDA: 26.3
Isobutyryl-CoA: 24.8
Benzoyl-CoA: 24.7
fatty_acid: 23.2
CHC-CoA: 15.0
Acetyl-CoA: 12.5
3-Methylbutyryl-CoA: 0.0

ctg46_18

Search NORINE for peptide: strict or relaxed

AMP-binding (541..950): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1617..2024): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

ctg46_21

Search NORINE for peptide: strict or relaxed

AMP-binding (291..689): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1368..1776): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2446..2842): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3505..3908): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGtIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

AMP-binding (4573..4982): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DaQYlAyVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

AMP-binding (5652..6053): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGtIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

ctg46_23

Search NORINE for peptide: strict or relaxed

AMP-binding (429..835): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1508..1914): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2584..2994): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiEdIGSVaK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 70% (weak)

AMP-binding (3655..4062): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDvGtVsK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (4728..5127): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00048_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 16,506 nt. (total: 16,506 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 16506:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - ala - ala - gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg48_1

PKS_AT (120..441): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 135.9
inactive: 73.2
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 51.2
Ethylmalonyl-CoA: 33.8
Propionyl-CoA: 29.2
2-Methylbutyryl-CoA: 21.9
Isobutyryl-CoA: 18.7
CHC-CoA: 15.8
trans-1,2-CPDA: 13.2
Benzoyl-CoA: 12.8
fatty_acid: 11.8
3-Methylbutyryl-CoA: 10.8
Acetyl-CoA: 10.3

ctg48_2

Search NORINE for peptide: strict or relaxed

AMP-binding (197..605): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DvyITtqVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (1281..1686): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2348..2746): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (3408..3808): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAcQFGaIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

c00049_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 63,393 nt. (total: 63,393 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 63393:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys) + (mal - X) + (ser - thr - X - ala - val - X - mal - D-X) + (phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg49_1

Search NORINE for peptide: strict or relaxed

AMP-binding (848..1134): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (1796..2102): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg49_3

Search NORINE for peptide: strict or relaxed

CAL_domain (43..493): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 49.7
NH2: 26.6
AHBA: 4.4
shikimic_acid: 0.0
fatty_acid: -3.0

PKS_AT (1207..1507): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.9
Methylmalonyl-CoA: 92.4
Methoxymalonyl-CoA: 88.0
inactive: 84.2
Propionyl-CoA: 67.4
2-Methylbutyryl-CoA: 58.7
Ethylmalonyl-CoA: 55.0
CHC-CoA: 49.1
Isobutyryl-CoA: 43.2
fatty_acid: 38.6
Benzoyl-CoA: 32.2
trans-1,2-CPDA: 27.8
Acetyl-CoA: 18.9
3-Methylbutyryl-CoA: 18.0

AMP-binding (3007..3421): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

ctg49_10

Search NORINE for peptide: strict or relaxed

CAL_domain (35..449): pk

minowa: NH2

Prediction, score:

NH2: 186.0
fatty_acid: 21.9
AHBA: 21.6
Acetyl-CoA: 6.6
shikimic_acid: 0.0

AMP-binding (1127..1535): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2195..2605): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3271..3670): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (4774..5188): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (5847..6230): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

A-OX (6899..7687): X

PKS_AT (8717..9042): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 142.2
inactive: 74.8
Methoxymalonyl-CoA: 60.5
Methylmalonyl-CoA: 53.5
Propionyl-CoA: 36.2
Isobutyryl-CoA: 21.6
Ethylmalonyl-CoA: 20.5
fatty_acid: 11.0
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: 9.5
Acetyl-CoA: 8.5
CHC-CoA: 5.8
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (10240..10643): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg49_11

Search NORINE for peptide: strict or relaxed

AMP-binding (479..852): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlIgAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

c00053_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 136,384 - 205,407 nt. (total: 69,024 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 136383 - 205407:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - leu - pro - X - X - X - ser - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg53_112

Search NORINE for peptide: strict or relaxed

CAL_domain (171..489): pk

minowa: NH2

Prediction, score:

NH2: 180.7
Acetyl-CoA: 53.6
fatty_acid: 28.8
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1206..1603): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2279..2675): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (3355..3762): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: cVQhIAqVIK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

AMP-binding (4470..4874): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvaQyGLvDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (5616..6025): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (6767..7192): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DlWHaGlVwK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (7855..8233): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (8885..9305): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00053_3300010.. - Region 2 - NRPS,T1PKS

Download region GenBank file

Location: 216,433 - 393,087 nt. (total: 176,655 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 216432 - 393087:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - cys) + (mal - gly - pro) + (ile - X - X - val - ala - X) + (gln - cys - thr - tyr) + (mal - X - X - X - X) + (ile - X - pro - X) + (X - X) + (mal - X) + (mal - leu) + (ala - X - ser - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg53_145

Search NORINE for peptide: strict or relaxed

CAL_domain (41..473): pk

minowa: NH2

Prediction, score:

NH2: 173.7
AHBA: 37.1
shikimic_acid: 16.8
Acetyl-CoA: 5.6
fatty_acid: 0.0

AMP-binding (1140..1528): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2182..2575): X

NRPSPredictor2: val, ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAplLGCTFK
Nearest Stachelhaus code:: val, ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (3257..3657): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (4322..4750): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg53_156

Search NORINE for peptide: strict or relaxed

PKS_AT (549..828): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.4
inactive: 89.3
Methoxymalonyl-CoA: 68.4
Methylmalonyl-CoA: 53.5
Propionyl-CoA: 32.6
Ethylmalonyl-CoA: 31.7
Isobutyryl-CoA: 24.1
CHC-CoA: 19.9
fatty_acid: 17.7
2-Methylbutyryl-CoA: 15.3
Benzoyl-CoA: 13.7
Acetyl-CoA: 12.6
trans-1,2-CPDA: 10.7
3-Methylbutyryl-CoA: 7.9

AMP-binding (2506..2906): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvFFgGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

ctg53_162

Search NORINE for peptide: strict or relaxed

PKS_AT (539..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 131.6
inactive: 80.0
Methoxymalonyl-CoA: 77.6
Methylmalonyl-CoA: 59.7
Propionyl-CoA: 41.5
Ethylmalonyl-CoA: 38.0
Isobutyryl-CoA: 36.0
2-Methylbutyryl-CoA: 24.5
Benzoyl-CoA: 17.4
3-Methylbutyryl-CoA: 13.5
Acetyl-CoA: 11.3
fatty_acid: 10.9
trans-1,2-CPDA: 9.9
CHC-CoA: 8.9

AMP-binding (1510..1947): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWNiAMVfK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

ctg53_165

Search NORINE for peptide: strict or relaxed

AMP-binding (508..917): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiESIGtitK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (1651..2046): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgfYyAlVlK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

ctg53_167

Search NORINE for peptide: strict or relaxed

AMP-binding (481..857): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (1541..1976): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (2712..3138): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DAhFfshVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (4520..4929): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDIGtVvK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

ctg53_172

Search NORINE for peptide: strict or relaxed

PKS_AT (532..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.7
inactive: 101.0
Methoxymalonyl-CoA: 80.4
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 35.6
Ethylmalonyl-CoA: 30.1
Isobutyryl-CoA: 22.4
Acetyl-CoA: 21.8
2-Methylbutyryl-CoA: 20.6
CHC-CoA: 14.9
fatty_acid: 10.4
trans-1,2-CPDA: 8.8
Benzoyl-CoA: 8.3
3-Methylbutyryl-CoA: 0.0

AMP-binding (2011..2411): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALVsGcifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (3418..3818): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpLVnGfifK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

AMP-binding (4502..4901): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (5593..5996): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDmGsVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

ctg53_173

Search NORINE for peptide: strict or relaxed

AMP-binding (461..862): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1948): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (2620..3019): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3691..4093): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg53_174

Search NORINE for peptide: strict or relaxed

AMP-binding (428..823): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (1486..1890): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeMtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

AMP-binding (2892..3296): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeMtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

AMP-binding (3967..4367): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (5028..5418): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (6088..6489): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmHvGGlaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

ctg53_175

Search NORINE for peptide: strict or relaxed

PKS_AT (536..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.7
inactive: 99.7
Methoxymalonyl-CoA: 82.9
Methylmalonyl-CoA: 64.3
Propionyl-CoA: 46.1
Ethylmalonyl-CoA: 40.3
2-Methylbutyryl-CoA: 34.5
fatty_acid: 28.2
Benzoyl-CoA: 24.7
Isobutyryl-CoA: 24.5
CHC-CoA: 24.3
trans-1,2-CPDA: 16.6
Acetyl-CoA: 15.2
3-Methylbutyryl-CoA: 8.8

AMP-binding (1470..1867): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2951..3352): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DvyITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

ctg53_176

Search NORINE for peptide: strict or relaxed

CAL_domain (50..468): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 27.9
NH2: 21.0
AHBA: 10.3
shikimic_acid: 8.7
Acetyl-CoA: 4.0

AMP-binding (1137..1512): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (2152..2540): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3557..3832): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdMSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

c00054_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,055 nt. (total: 5,055 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5055:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg54_1

Search NORINE for peptide: strict or relaxed

AMP-binding (416..822): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DveeLGVVtK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00057_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 26,358 nt. (total: 26,358 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - ala - X - ala - pro - X - ala - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg57_1

Search NORINE for peptide: strict or relaxed

AMP-binding (309..721): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1416..1818): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2482..2883): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (3570..3980): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (4644..5046): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DahITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (5733..6137): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLilK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (6828..7226): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (7889..8296): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

c00058_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 48,973 nt. (total: 48,973 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 48973:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal) + (mal - X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_1

Search NORINE for peptide: strict or relaxed

AMP-binding (43..444): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAyfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (805..1209): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVknqGAdtK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 50% (weak)

AMP-binding (1891..2288): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWfvgAICK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg58_3

Search NORINE for peptide: strict or relaxed

PKS_AT (537..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methoxymalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.5
Methoxymalonyl-CoA: 67.2
inactive: 65.5
Methylmalonyl-CoA: 58.9
Propionyl-CoA: 42.9
Ethylmalonyl-CoA: 27.5
2-Methylbutyryl-CoA: 25.7
Isobutyryl-CoA: 14.6
fatty_acid: 13.8
trans-1,2-CPDA: 13.4
Acetyl-CoA: 11.9
CHC-CoA: 10.1
3-Methylbutyryl-CoA: 7.2
Benzoyl-CoA: 0.0

AMP-binding (1513..1931): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTvtK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 60% (weak)

ctg58_5

Search NORINE for peptide: strict or relaxed

CAL_domain (50..500): pk

minowa: NH2

Prediction, score:

NH2: 205.6
AHBA: 29.8
shikimic_acid: 16.8
fatty_acid: 10.8
Acetyl-CoA: -1.0

AMP-binding (1191..1592): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: asGsLGGVCK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

PKS_AT (2325..2618): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.1
inactive: 87.1
Methoxymalonyl-CoA: 82.0
Methylmalonyl-CoA: 72.4
Isobutyryl-CoA: 47.0
Ethylmalonyl-CoA: 46.8
Propionyl-CoA: 46.2
2-Methylbutyryl-CoA: 26.2
Benzoyl-CoA: 22.1
trans-1,2-CPDA: 21.8
CHC-CoA: 20.1
Acetyl-CoA: 18.6
fatty_acid: 12.8
3-Methylbutyryl-CoA: 5.4

c00058_3300010.. - Region 2 - NRPS

Download region GenBank file

Location: 162,325 - 218,887 nt. (total: 56,563 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 162324 - 218887:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - pro - val - ile - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_125

Search NORINE for peptide: strict or relaxed

AMP-binding (481..883): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1612..2031): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DAhFfaqVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (2696..3119): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAyfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (3788..4188): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DgLvIGlTgK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (4927..5327): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDIGtVvK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

c00060_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 23,944 nt. (total: 23,944 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 23944:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X - ile - ala - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg60_3

Search NORINE for peptide: strict or relaxed

AMP-binding (8..421): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLmvK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

ctg60_4

Search NORINE for peptide: strict or relaxed

AMP-binding (512..892): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArgLsqLtK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 50% (weak)

AMP-binding (1572..1983): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLalVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

AMP-binding (2650..3058): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAwFLGvTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (4162..4558): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNaALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (5236..5635): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

c00061_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,905 nt. (total: 5,905 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5905:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg61_1

Search NORINE for peptide: strict or relaxed

AMP-binding (682..1088): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00062_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 31,157 nt. (total: 31,157 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 31157:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg62_2

Search NORINE for peptide: strict or relaxed

AMP-binding (605..1028): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAveMGsVvK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (1711..2129): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAveMGsVvK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (2806..3210): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNcALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

c00068_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 102,948 nt. (total: 102,948 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 102948:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - ala - ala - mal - leu - gly) + (val) + (ala - val - pro - mal - pro) + (val - X - X - ala - ala) + (D-thr - gly - X - ala - ala - tyr - X - X - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg68_1

Search NORINE for peptide: strict or relaxed

AMP-binding (479..882): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAYfiGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1560..1960): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2622..3033): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

PKS_AT (3748..4072): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 132.5
inactive: 72.8
Methoxymalonyl-CoA: 68.7
Methylmalonyl-CoA: 53.1
Ethylmalonyl-CoA: 31.8
Propionyl-CoA: 27.9
Isobutyryl-CoA: 23.2
2-Methylbutyryl-CoA: 21.8
trans-1,2-CPDA: 16.5
CHC-CoA: 16.1
Benzoyl-CoA: 15.0
fatty_acid: 11.3
Acetyl-CoA: 10.9
3-Methylbutyryl-CoA: 10.9

AMP-binding (4747..5150): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (5815..6219): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg68_4

Search NORINE for peptide: strict or relaxed

AMP-binding (250..637): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

ctg68_5

Search NORINE for peptide: strict or relaxed

CAL_domain (50..467): pk

minowa: NH2

Prediction, score:

NH2: 188.7
AHBA: 22.3
fatty_acid: 22.2
Acetyl-CoA: 5.0
shikimic_acid: 0.8

AMP-binding (1153..1547): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2278..2655): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (3393..3867): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DvyITthVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

PKS_AT (4582..4893): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.1
inactive: 73.4
Methoxymalonyl-CoA: 72.8
Methylmalonyl-CoA: 58.9
Ethylmalonyl-CoA: 37.7
Propionyl-CoA: 34.8
Isobutyryl-CoA: 29.5
2-Methylbutyryl-CoA: 24.2
CHC-CoA: 17.5
Benzoyl-CoA: 13.8
Acetyl-CoA: 11.0
3-Methylbutyryl-CoA: 10.5
fatty_acid: 9.9
trans-1,2-CPDA: 7.4

AMP-binding (5905..6312): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DvyVttqVAK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

ctg68_7

Search NORINE for peptide: strict or relaxed

AMP-binding (473..869): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1540..1921): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmtqLAAVlK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (2611..3020): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (3709..4127): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (4809..5212): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

ctg68_17

Search NORINE for peptide: strict or relaxed

AMP-binding (754..1160): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2253..2667): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DItQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

AMP-binding (3351..3762): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

AMP-binding (4438..4832): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (5496..5895): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (6556..6939): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (7598..8015): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvyraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

AMP-binding (8697..9109): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLivK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (9776..10188): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DgTKfGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

c00069_3300010.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 23,493 nt. (total: 23,493 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00069_3300010.. - Region 2 - NRPS

Download region GenBank file

Location: 52,347 - 90,834 nt. (total: 38,488 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00070_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 38,538 - 64,097 nt. (total: 25,560 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg70_43 - Putative Class II

ctg70_40 leader / core peptide: MKKRLLDKKLLLSRETVRNLMSTELRYVAGG - DhaDCDhbDKPDhbRGALDhaACDCDhaDhbDhaADhbADhaDDhbCNECDhaDhbVQW
ctg70_41 leader / core peptide: MLELDIQRAWRDGEYFLSLTDEQKAMIPNSPAGAVEMANGEVAAFGG - ACDhaNDhbFQDhaWCFNDhaLCDhbDhaKCDhaCIC
ctg70_42 leader / core peptide: MLGVDIQRAWRDGEYFLSLTDEQKAMIPNSPAGAIEVANGEVAIFGG - ACANDhaQQDhaWCYNDhaACADhbKCDhaCIC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg70_40 - Class II

Cleavage pHMM score: 1.30

RODEO score: 0

Monoisotopic mass: 3397.4 Da

Molecular weight: 3399.6 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 3417.6 Da N = 1; 3435.6 Da N = 2; 3453.7 Da N = 3; 3471.7 Da N = 4; 3489.7 Da N = 5; 3507.7 Da N = 6; 3525.7 Da N = 7

ctg70_41 - Class II

Cleavage pHMM score: -5.90

RODEO score: 0

Monoisotopic mass: 2409.0 Da

Molecular weight: 2410.8 Da

Number of bridges: 6

Alternative weights: (assuming N unmodified Ser/Thr residues); 2428.8 Da N = 1

ctg70_42 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 2353.9 Da

Molecular weight: 2355.7 Da

Number of bridges: 5

c00071_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 17,281 - 82,070 nt. (total: 64,790 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 17280 - 82070:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - D-X) + (ser - thr - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg71_40

Search NORINE for peptide: strict or relaxed

AMP-binding (923..1201): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdlSmVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

AMP-binding (1868..2268): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgfYhAlVlK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

ctg71_44

Search NORINE for peptide: strict or relaxed

CAL_domain (42..490): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 34.0
NH2: 31.8
AHBA: 19.1
shikimic_acid: 0.0
fatty_acid: -1.3

AMP-binding (1167..1557): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (2620..3034): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3707..4111): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00072_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,647 nt. (total: 6,647 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6647:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg72_6

Search NORINE for peptide: strict or relaxed

AMP-binding (301..677): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00073_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 59,771 - 132,588 nt. (total: 72,818 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 59770 - 132588:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - X - pro - cys) + (ohmal) + (D-leu - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg73_33

Search NORINE for peptide: strict or relaxed

CAL_domain (43..487): pk

minowa: NH2

Prediction, score:

NH2: 177.8
Acetyl-CoA: 46.4
fatty_acid: 29.0
AHBA: 18.9
shikimic_acid: -1.7

AMP-binding (1170..1565): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2221..2620): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3370..3763): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (4435..4851): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFmAHaAK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (5946..6216): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLwdlSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

ctg73_34

PKS_AT (544..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.8
inactive: 73.1
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 45.7
Ethylmalonyl-CoA: 18.9
Propionyl-CoA: 17.9
Isobutyryl-CoA: 16.7
3-Methylbutyryl-CoA: 9.5
2-Methylbutyryl-CoA: 6.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0

ctg73_37

Search NORINE for peptide: strict or relaxed

AMP-binding (15..298): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DaLFagSVLK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 70% (weak)

AMP-binding (1429..1822): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DlLWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00073_3300010.. - Region 2 - NRPS

Download region GenBank file

Location: 216,586 - 292,431 nt. (total: 75,846 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 216585 - 292431:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - orn - D-asn - thr - val - X - val - X - D-asn - tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg73_142

Search NORINE for peptide: strict or relaxed

AMP-binding (474..871): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1540..1960): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGElGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 90% (moderate)

AMP-binding (2661..3059): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (4232..4691): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5358..5758): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (6428..6846): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEvSSIDK
Nearest Stachelhaus code:: dab
Stachelhaus code match:: 90% (moderate)

AMP-binding (7506..7898): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (8570..8967): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (9627..10038): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (11140..11518): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00073_3300010.. - Region 3 - NRPS

Download region GenBank file

Location: 313,015 - 460,463 nt. (total: 147,449 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 313014 - 460463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - gly - X - ser - ile - val - cys - ala - pro - X - X) + (cys) + (ile - ala)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 313014 - 364845:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys) + (ile - ala)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 354191 - 460463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - gly - X - ser - ile - val - cys - ala - pro - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg73_192

Search NORINE for peptide: strict or relaxed

AMP-binding (518..910): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAcFLGaTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (1571..1938): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg73_194

Search NORINE for peptide: strict or relaxed

AMP-binding (945..1352): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DmYHLGLmdK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg73_217

Search NORINE for peptide: strict or relaxed

AMP-binding (21..428): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gLvnfGGPvK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

ctg73_225

Search NORINE for peptide: strict or relaxed

AMP-binding (508..880): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIiQwGLVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (1567..1953): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIiQwGLVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (2608..3020): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIiQwGLIyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (3681..4087): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVegVGgVtK
Nearest Stachelhaus code:: d-lyserg
Stachelhaus code match:: 60% (weak)

AMP-binding (4749..5165): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlgLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

AMP-binding (5819..6213): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAwFLGvTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 80% (moderate)

AMP-binding (6924..7319): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAyfLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (8037..8441): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdlSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

CAL_domain (9246..9663): pk

minowa: NH2

Prediction, score:

NH2: 30.9
fatty_acid: 23.9
AHBA: 11.5
shikimic_acid: 0.0
Acetyl-CoA: -2.1

AMP-binding (10848..11223): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (11883..12284): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DaQYmAyVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 70% (weak)

AMP-binding (12946..13349): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVrHFaLlaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 60% (weak)

AMP-binding (14042..14452): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGfVwK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 80% (moderate)

c00073_3300010.. - Region 4 - bacteriocin

Download region GenBank file

Location: 479,847 - 490,752 nt. (total: 10,906 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00074_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 10,155 nt. (total: 10,155 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10155:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - val - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg74_1

Search NORINE for peptide: strict or relaxed

AMP-binding (3..268): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (932..1331): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (2012..2410): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGGVnK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (3089..3382): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00075_3300010.. - Region 1 - terpene

Download region GenBank file

Location: 1 - 17,711 nt. (total: 17,711 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00076_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,764 nt. (total: 4,764 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4764:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg76_1

Search NORINE for peptide: strict or relaxed

AMP-binding (694..1091): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DvyITAqVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

c00082_3300010.. - Region 1 - NRPS,T1PKS,terpene

Download region GenBank file

Location: 44,403 - 119,691 nt. (total: 75,289 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 44402 - 119691:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - X - X - val - leu - ile - val) + (ile - val) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg82_54

PKS_AT (533..894): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 137.1
Methoxymalonyl-CoA: 73.2
inactive: 67.9
Methylmalonyl-CoA: 58.4
Propionyl-CoA: 49.5
Ethylmalonyl-CoA: 33.6
Isobutyryl-CoA: 30.6
2-Methylbutyryl-CoA: 29.3
fatty_acid: 27.4
trans-1,2-CPDA: 25.1
CHC-CoA: 25.1
Benzoyl-CoA: 24.0
Acetyl-CoA: 23.5
3-Methylbutyryl-CoA: 21.8

ctg82_55

Search NORINE for peptide: strict or relaxed

AMP-binding (523..921): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (1590..1987): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg82_56

Search NORINE for peptide: strict or relaxed

AMP-binding (516..937): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1612..2016): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHLgeIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (2679..3085): X

NRPSPredictor2: ser, thr, dhpg, hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHLgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

AMP-binding (3802..4184): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (5280..5674): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAaiLGhVlK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

AMP-binding (6337..6735): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (7403..7801): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWlGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00084_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 71,635 nt. (total: 71,635 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 71635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala - X - X - pro - ohmal) + (thr - pro - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg84_20

Search NORINE for peptide: strict or relaxed

AMP-binding (601..980): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1639..2036): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2707..3116): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLifK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (4210..4641): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvENiGgItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (5313..5728): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQSlAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

PKS_AT (6503..6835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.3
inactive: 87.6
Methoxymalonyl-CoA: 53.4
Methylmalonyl-CoA: 39.4
Isobutyryl-CoA: 16.7
Propionyl-CoA: 14.0
Benzoyl-CoA: 14.0
2-Methylbutyryl-CoA: 10.7
3-Methylbutyryl-CoA: 10.6
Ethylmalonyl-CoA: 9.8
CHC-CoA: 3.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Acetyl-CoA: 0.0

ctg84_21

Search NORINE for peptide: strict or relaxed

AMP-binding (525..923): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1599..2011): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (2682..3082): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00086_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 175,775 - 228,158 nt. (total: 52,384 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 175774 - 228158:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-X) + (D-X - D-X - X - val - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg86_150

Search NORINE for peptide: strict or relaxed

AMP-binding (472..883): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGiVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (2019..2422): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (3587..3979): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (4645..5045): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (5723..6115): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNsALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

AMP-binding (6786..7172): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFtitLLsK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 60% (weak)

ctg86_151

Search NORINE for peptide: strict or relaxed

AMP-binding (524..928): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvVtK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

AMP-binding (2055..2458): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

c00087_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 7,043 - 65,700 nt. (total: 58,658 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 7042 - 65700:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 7042 - 51434:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 11454 - 65700:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg87_29

PKS_AT (541..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.3
inactive: 76.2
Methoxymalonyl-CoA: 71.2
Methylmalonyl-CoA: 59.0
Isobutyryl-CoA: 46.4
Propionyl-CoA: 35.4
Ethylmalonyl-CoA: 34.5
fatty_acid: 29.1
trans-1,2-CPDA: 22.9
CHC-CoA: 22.3
2-Methylbutyryl-CoA: 22.3
Benzoyl-CoA: 20.4
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg87_30

Search NORINE for peptide: strict or relaxed

AMP-binding (541..941): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEnVGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 80% (moderate)

ctg87_31

Search NORINE for peptide: strict or relaxed

AMP-binding (506..919): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgLvvGGTlK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (1638..2039): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (2957..3364): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

c00088_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 30,158 nt. (total: 30,158 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 30158:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg88_2

Search NORINE for peptide: strict or relaxed

AMP-binding (508..911): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAyiLGmTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

AMP-binding (2088..2492): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

c00089_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 56,099 - 67,046 nt. (total: 10,948 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00090_3300010.. - Region 1 - T1PKS,lanthipeptide

Download region GenBank file

Location: 54,631 - 101,613 nt. (total: 46,983 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00090_3300010.. - Region 2 - lanthipeptide

Download region GenBank file

Location: 173,089 - 195,536 nt. (total: 22,448 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00091_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 11,845 nt. (total: 11,845 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11845:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg91_2

Search NORINE for peptide: strict or relaxed

CAL_domain (49..488): pk

minowa: NH2

Prediction, score:

NH2: 193.2
fatty_acid: 12.2
AHBA: 10.9
Acetyl-CoA: 9.1
shikimic_acid: 0.0

AMP-binding (1166..1574): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DffHhGgINK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 60% (weak)

AMP-binding (2243..2632): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (3307..3570): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLF-eA---K
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

c00092_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,094 nt. (total: 3,094 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains