3300010401_10 - 30 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00028_3300010.. (original name was: 3300010401.a:Ga0134121_10016837)

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	T1PKS,NRPS-like	1	5,824

c00039_3300010.. (original name was: 3300010401.a:Ga0134121_10001717)

Region	Type	From	To	Most similar known cluster		Similarity
Region 39.1	NRPS	1	20,198

c00049_3300010.. (original name was: 3300010401.a:Ga0134121_10000932)

Region	Type	From	To	Most similar known cluster		Similarity
Region 49.1	lanthipeptide	3,212	25,617

c00058_3300010.. (original name was: 3300010401.a:Ga0134121_10000074)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	NRPS,T1PKS	1	89,352

c00062_3300010.. (original name was: 3300010401.a:Ga0134121_10000569)

Region	Type	From	To	Most similar known cluster		Similarity
Region 62.1	T1PKS	1	36,446

c00067_3300010.. (original name was: 3300010401.a:Ga0134121_10023587)

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	NRPS	1	4,936

c00068_3300010.. (original name was: 3300010401.a:Ga0134121_10000537)

Region	Type	From	To	Most similar known cluster		Similarity
Region 68.1	lanthipeptide	21,163	42,548

c00073_3300010.. (original name was: 3300010401.a:Ga0134121_10019156)

Region	Type	From	To	Most similar known cluster		Similarity
Region 73.1	NRPS	1	5,461

c00092_3300010.. (original name was: 3300010401.a:Ga0134121_10000353)

Region	Type	From	To	Most similar known cluster		Similarity
Region 92.1	NRPS,T1PKS	1	53,825

c00103_3300010.. (original name was: 3300010401.a:Ga0134121_10004316)

Region	Type	From	To	Most similar known cluster		Similarity
Region 103.1	T3PKS	1	11,679

c00106_3300010.. (original name was: 3300010401.a:Ga0134121_10000849)

Region	Type	From	To	Most similar known cluster		Similarity
Region 106.1	NRPS	1	31,525

c00109_3300010.. (original name was: 3300010401.a:Ga0134121_10000222)

Region	Type	From	To	Most similar known cluster		Similarity
Region 109.1	NRPS,T1PKS	971	68,427

c00120_3300010.. (original name was: 3300010401.a:Ga0134121_10055389)

Region	Type	From	To	Most similar known cluster		Similarity
Region 120.1	NRPS	1	3,259

c00132_3300010.. (original name was: 3300010401.a:Ga0134121_10011507)

Region	Type	From	To	Most similar known cluster		Similarity
Region 132.1	NRPS	1	7,036

c00138_3300010.. (original name was: 3300010401.a:Ga0134121_10000186)

Region	Type	From	To	Most similar known cluster		Similarity
Region 138.1	terpene	19,539	40,477

c00148_3300010.. (original name was: 3300010401.a:Ga0134121_10001363)

Region	Type	From	To	Most similar known cluster		Similarity
Region 148.1	NRPS	1	23,117

c00149_3300010.. (original name was: 3300010401.a:Ga0134121_10001468)

Region	Type	From	To	Most similar known cluster		Similarity
Region 149.1	NRPS	1	22,147

c00154_3300010.. (original name was: 3300010401.a:Ga0134121_10000311)

Region	Type	From	To	Most similar known cluster		Similarity
Region 154.1	lanthipeptide	26,450	52,938

c00168_3300010.. (original name was: 3300010401.a:Ga0134121_10000594)

Region	Type	From	To	Most similar known cluster		Similarity
Region 168.1	NRPS,T1PKS	1,654	40,172

c00172_3300010.. (original name was: 3300010401.a:Ga0134121_10000141)

Region	Type	From	To	Most similar known cluster		Similarity
Region 172.1	lanthipeptide	12,646	35,864

c00173_3300010.. (original name was: 3300010401.a:Ga0134121_10000615)

Region	Type	From	To	Most similar known cluster		Similarity
Region 173.1	T1PKS	13,102	39,114

c00184_3300010.. (original name was: 3300010401.a:Ga0134121_10003659)

Region	Type	From	To	Most similar known cluster		Similarity
Region 184.1	NRPS	1	12,742

c00188_3300010.. (original name was: 3300010401.a:Ga0134121_10000150)

Region	Type	From	To	Most similar known cluster		Similarity
Region 188.1	bacteriocin	69,600	80,547

c00216_3300010.. (original name was: 3300010401.a:Ga0134121_10000368)

Region	Type	From	To	Most similar known cluster		Similarity
Region 216.1	NRPS	29,992	52,466

c00217_3300010.. (original name was: 3300010401.a:Ga0134121_10003231)

Region	Type	From	To	Most similar known cluster		Similarity
Region 217.1	ladderane	1	13,690

c00230_3300010.. (original name was: 3300010401.a:Ga0134121_10000468)

Region	Type	From	To	Most similar known cluster		Similarity
Region 230.1	TfuA-related	15,268	37,932

c00232_3300010.. (original name was: 3300010401.a:Ga0134121_10000586)

Region	Type	From	To	Most similar known cluster		Similarity
Region 232.1	bacteriocin	1,338	13,371

c00234_3300010.. (original name was: 3300010401.a:Ga0134121_10000162)

Region	Type	From	To	Most similar known cluster		Similarity
Region 234.1	NRPS-like,T1PKS	43,305	78,419

c00243_3300010.. (original name was: 3300010401.a:Ga0134121_10000229)

Region	Type	From	To	Most similar known cluster		Similarity
Region 243.1	NRPS,T1PKS	23,371	67,203

c00251_3300010.. (original name was: 3300010401.a:Ga0134121_10000117)

Region	Type	From	To	Most similar known cluster		Similarity
Region 251.1	NRPS-like	46,696	90,733

Region	Type	From	To	Similarity
Region 28.1	T1PKS,NRPS-like	1	5,824
Region 39.1	NRPS	1	20,198
Region 49.1	lanthipeptide	3,212	25,617
Region 58.1	NRPS,T1PKS	1	89,352
Region 62.1	T1PKS	1	36,446
Region 67.1	NRPS	1	4,936
Region 68.1	lanthipeptide	21,163	42,548
Region 73.1	NRPS	1	5,461
Region 92.1	NRPS,T1PKS	1	53,825
Region 103.1	T3PKS	1	11,679
Region 106.1	NRPS	1	31,525
Region 109.1	NRPS,T1PKS	971	68,427
Region 120.1	NRPS	1	3,259
Region 132.1	NRPS	1	7,036
Region 138.1	terpene	19,539	40,477
Region 148.1	NRPS	1	23,117
Region 149.1	NRPS	1	22,147
Region 154.1	lanthipeptide	26,450	52,938
Region 168.1	NRPS,T1PKS	1,654	40,172
Region 172.1	lanthipeptide	12,646	35,864
Region 173.1	T1PKS	13,102	39,114
Region 184.1	NRPS	1	12,742
Region 188.1	bacteriocin	69,600	80,547
Region 216.1	NRPS	29,992	52,466
Region 217.1	ladderane	1	13,690
Region 230.1	TfuA-related	15,268	37,932
Region 232.1	bacteriocin	1,338	13,371
Region 234.1	NRPS-like,T1PKS	43,305	78,419
Region 243.1	NRPS,T1PKS	23,371	67,203
Region 251.1	NRPS-like	46,696	90,733

No secondary metabolite regions were found in these records:: c00001_3300010.. (original name was: 3300010401.a:Ga0134121_10052539); c00002_3300010.. (original name was: 3300010401.a:Ga0134121_10041350); c00003_3300010.. (original name was: 3300010401.a:Ga0134121_10038536); c00004_3300010.. (original name was: 3300010401.a:Ga0134121_10034626); c00005_3300010.. (original name was: 3300010401.a:Ga0134121_10013164); c00006_3300010.. (original name was: 3300010401.a:Ga0134121_10003222); c00007_3300010.. (original name was: 3300010401.a:Ga0134121_10004255); c00008_3300010.. (original name was: 3300010401.a:Ga0134121_10001883); c00009_3300010.. (original name was: 3300010401.a:Ga0134121_10050144); c00010_3300010.. (original name was: 3300010401.a:Ga0134121_10002437); c00011_3300010.. (original name was: 3300010401.a:Ga0134121_10001167); c00012_3300010.. (original name was: 3300010401.a:Ga0134121_10012510); c00013_3300010.. (original name was: 3300010401.a:Ga0134121_10002019); c00014_3300010.. (original name was: 3300010401.a:Ga0134121_10003608); c00015_3300010.. (original name was: 3300010401.a:Ga0134121_10005270); c00016_3300010.. (original name was: 3300010401.a:Ga0134121_10003634); c00017_3300010.. (original name was: 3300010401.a:Ga0134121_10003390); c00018_3300010.. (original name was: 3300010401.a:Ga0134121_10002329); c00019_3300010.. (original name was: 3300010401.a:Ga0134121_10000573); c00020_3300010.. (original name was: 3300010401.a:Ga0134121_10000134); c00021_3300010.. (original name was: 3300010401.a:Ga0134121_10002697); c00022_3300010.. (original name was: 3300010401.a:Ga0134121_10003515); c00023_3300010.. (original name was: 3300010401.a:Ga0134121_10001593); c00024_3300010.. (original name was: 3300010401.a:Ga0134121_10000276); c00025_3300010.. (original name was: 3300010401.a:Ga0134121_10001390); c00026_3300010.. (original name was: 3300010401.a:Ga0134121_10004849); c00027_3300010.. (original name was: 3300010401.a:Ga0134121_10001797); c00029_3300010.. (original name was: 3300010401.a:Ga0134121_10003651); c00030_3300010.. (original name was: 3300010401.a:Ga0134121_10024779); c00031_3300010.. (original name was: 3300010401.a:Ga0134121_10001870); c00032_3300010.. (original name was: 3300010401.a:Ga0134121_10001074); c00033_3300010.. (original name was: 3300010401.a:Ga0134121_10005079); c00034_3300010.. (original name was: 3300010401.a:Ga0134121_10001279); c00035_3300010.. (original name was: 3300010401.a:Ga0134121_10001659); c00036_3300010.. (original name was: 3300010401.a:Ga0134121_10002114); c00037_3300010.. (original name was: 3300010401.a:Ga0134121_10001716); c00038_3300010.. (original name was: 3300010401.a:Ga0134121_10003033); c00040_3300010.. (original name was: 3300010401.a:Ga0134121_10001680); c00041_3300010.. (original name was: 3300010401.a:Ga0134121_10001841); c00042_3300010.. (original name was: 3300010401.a:Ga0134121_10000997); c00043_3300010.. (original name was: 3300010401.a:Ga0134121_10000119); c00044_3300010.. (original name was: 3300010401.a:Ga0134121_10024826); c00045_3300010.. (original name was: 3300010401.a:Ga0134121_10001660); c00046_3300010.. (original name was: 3300010401.a:Ga0134121_10001113); c00047_3300010.. (original name was: 3300010401.a:Ga0134121_10003302); c00048_3300010.. (original name was: 3300010401.a:Ga0134121_10002559); c00050_3300010.. (original name was: 3300010401.a:Ga0134121_10000054); c00051_3300010.. (original name was: 3300010401.a:Ga0134121_10000444); c00052_3300010.. (original name was: 3300010401.a:Ga0134121_10003031); c00053_3300010.. (original name was: 3300010401.a:Ga0134121_10000897); c00054_3300010.. (original name was: 3300010401.a:Ga0134121_10001089); c00055_3300010.. (original name was: 3300010401.a:Ga0134121_10000293); c00056_3300010.. (original name was: 3300010401.a:Ga0134121_10001069); c00057_3300010.. (original name was: 3300010401.a:Ga0134121_10001268); c00059_3300010.. (original name was: 3300010401.a:Ga0134121_10008233); c00060_3300010.. (original name was: 3300010401.a:Ga0134121_10001508); c00061_3300010.. (original name was: 3300010401.a:Ga0134121_10001584); c00063_3300010.. (original name was: 3300010401.a:Ga0134121_10000978); c00064_3300010.. (original name was: 3300010401.a:Ga0134121_10001652); c00065_3300010.. (original name was: 3300010401.a:Ga0134121_10001066); c00066_3300010.. (original name was: 3300010401.a:Ga0134121_10000657); c00069_3300010.. (original name was: 3300010401.a:Ga0134121_10001590); c00070_3300010.. (original name was: 3300010401.a:Ga0134121_10018714); c00071_3300010.. (original name was: 3300010401.a:Ga0134121_10003707); c00072_3300010.. (original name was: 3300010401.a:Ga0134121_10046524); c00074_3300010.. (original name was: 3300010401.a:Ga0134121_10015773); c00075_3300010.. (original name was: 3300010401.a:Ga0134121_10000748); c00076_3300010.. (original name was: 3300010401.a:Ga0134121_10011353); c00077_3300010.. (original name was: 3300010401.a:Ga0134121_10027653); c00078_3300010.. (original name was: 3300010401.a:Ga0134121_10016039); c00079_3300010.. (original name was: 3300010401.a:Ga0134121_10000809); c00080_3300010.. (original name was: 3300010401.a:Ga0134121_10008132); c00081_3300010.. (original name was: 3300010401.a:Ga0134121_10000371); c00082_3300010.. (original name was: 3300010401.a:Ga0134121_10004100); c00083_3300010.. (original name was: 3300010401.a:Ga0134121_10000319); c00084_3300010.. (original name was: 3300010401.a:Ga0134121_10048559); c00085_3300010.. (original name was: 3300010401.a:Ga0134121_10000261); c00086_3300010.. (original name was: 3300010401.a:Ga0134121_10018142); c00087_3300010.. (original name was: 3300010401.a:Ga0134121_10040861); c00088_3300010.. (original name was: 3300010401.a:Ga0134121_10033823); c00089_3300010.. (original name was: 3300010401.a:Ga0134121_10005527); c00090_3300010.. (original name was: 3300010401.a:Ga0134121_10004034); c00091_3300010.. (original name was: 3300010401.a:Ga0134121_10000762); c00093_3300010.. (original name was: 3300010401.a:Ga0134121_10014946); c00094_3300010.. (original name was: 3300010401.a:Ga0134121_10037242); c00095_3300010.. (original name was: 3300010401.a:Ga0134121_10001240); c00096_3300010.. (original name was: 3300010401.a:Ga0134121_10000422); c00097_3300010.. (original name was: 3300010401.a:Ga0134121_10008691); c00098_3300010.. (original name was: 3300010401.a:Ga0134121_10000300); c00099_3300010.. (original name was: 3300010401.a:Ga0134121_10001527); c00100_3300010.. (original name was: 3300010401.a:Ga0134121_10001444); c00101_3300010.. (original name was: 3300010401.a:Ga0134121_10012866); c00102_3300010.. (original name was: 3300010401.a:Ga0134121_10000635); c00104_3300010.. (original name was: 3300010401.a:Ga0134121_10000977); c00105_3300010.. (original name was: 3300010401.a:Ga0134121_10049302); c00107_3300010.. (original name was: 3300010401.a:Ga0134121_10001159); c00108_3300010.. (original name was: 3300010401.a:Ga0134121_10001858); c00110_3300010.. (original name was: 3300010401.a:Ga0134121_10001018); c00111_3300010.. (original name was: 3300010401.a:Ga0134121_10002233); c00112_3300010.. (original name was: 3300010401.a:Ga0134121_10001824); c00113_3300010.. (original name was: 3300010401.a:Ga0134121_10000431); c00114_3300010.. (original name was: 3300010401.a:Ga0134121_10046582); c00115_3300010.. (original name was: 3300010401.a:Ga0134121_10007003); c00116_3300010.. (original name was: 3300010401.a:Ga0134121_10048360); c00117_3300010.. (original name was: 3300010401.a:Ga0134121_10000436); c00118_3300010.. (original name was: 3300010401.a:Ga0134121_10001864); c00119_3300010.. (original name was: 3300010401.a:Ga0134121_10001046); c00121_3300010.. (original name was: 3300010401.a:Ga0134121_10001643); c00122_3300010.. (original name was: 3300010401.a:Ga0134121_10000449); c00123_3300010.. (original name was: 3300010401.a:Ga0134121_10000927); c00124_3300010.. (original name was: 3300010401.a:Ga0134121_10001557); c00125_3300010.. (original name was: 3300010401.a:Ga0134121_10000330); c00126_3300010.. (original name was: 3300010401.a:Ga0134121_10002320); c00127_3300010.. (original name was: 3300010401.a:Ga0134121_10001400); c00128_3300010.. (original name was: 3300010401.a:Ga0134121_10027419); c00129_3300010.. (original name was: 3300010401.a:Ga0134121_10020832); c00130_3300010.. (original name was: 3300010401.a:Ga0134121_10004407); c00131_3300010.. (original name was: 3300010401.a:Ga0134121_10000540); c00133_3300010.. (original name was: 3300010401.a:Ga0134121_10001219); c00134_3300010.. (original name was: 3300010401.a:Ga0134121_10042786); c00135_3300010.. (original name was: 3300010401.a:Ga0134121_10003680); c00136_3300010.. (original name was: 3300010401.a:Ga0134121_10047083); c00137_3300010.. (original name was: 3300010401.a:Ga0134121_10003049); c00139_3300010.. (original name was: 3300010401.a:Ga0134121_10011593); c00140_3300010.. (original name was: 3300010401.a:Ga0134121_10036555); c00141_3300010.. (original name was: 3300010401.a:Ga0134121_10007622); c00142_3300010.. (original name was: 3300010401.a:Ga0134121_10000260); c00143_3300010.. (original name was: 3300010401.a:Ga0134121_10008816); c00144_3300010.. (original name was: 3300010401.a:Ga0134121_10001454); c00145_3300010.. (original name was: 3300010401.a:Ga0134121_10046741); c00146_3300010.. (original name was: 3300010401.a:Ga0134121_10016733); c00147_3300010.. (original name was: 3300010401.a:Ga0134121_10007907); c00150_3300010.. (original name was: 3300010401.a:Ga0134121_10000535); c00151_3300010.. (original name was: 3300010401.a:Ga0134121_10011073); c00152_3300010.. (original name was: 3300010401.a:Ga0134121_10003362); c00153_3300010.. (original name was: 3300010401.a:Ga0134121_10000908); c00155_3300010.. (original name was: 3300010401.a:Ga0134121_10001152); c00156_3300010.. (original name was: 3300010401.a:Ga0134121_10029858); c00157_3300010.. (original name was: 3300010401.a:Ga0134121_10001032); c00158_3300010.. (original name was: 3300010401.a:Ga0134121_10000833); c00159_3300010.. (original name was: 3300010401.a:Ga0134121_10003876); c00160_3300010.. (original name was: 3300010401.a:Ga0134121_10000294); c00161_3300010.. (original name was: 3300010401.a:Ga0134121_10004756); c00162_3300010.. (original name was: 3300010401.a:Ga0134121_10010490); c00163_3300010.. (original name was: 3300010401.a:Ga0134121_10013077); c00164_3300010.. (original name was: 3300010401.a:Ga0134121_10000950); c00165_3300010.. (original name was: 3300010401.a:Ga0134121_10002586); c00166_3300010.. (original name was: 3300010401.a:Ga0134121_10000735); c00167_3300010.. (original name was: 3300010401.a:Ga0134121_10009324); c00169_3300010.. (original name was: 3300010401.a:Ga0134121_10003568); c00170_3300010.. (original name was: 3300010401.a:Ga0134121_10001932); c00171_3300010.. (original name was: 3300010401.a:Ga0134121_10013454); c00174_3300010.. (original name was: 3300010401.a:Ga0134121_10000805); c00175_3300010.. (original name was: 3300010401.a:Ga0134121_10000452); c00176_3300010.. (original name was: 3300010401.a:Ga0134121_10006178); c00177_3300010.. (original name was: 3300010401.a:Ga0134121_10001855); c00178_3300010.. (original name was: 3300010401.a:Ga0134121_10000628); c00179_3300010.. (original name was: 3300010401.a:Ga0134121_10018492); c00180_3300010.. (original name was: 3300010401.a:Ga0134121_10000344); c00181_3300010.. (original name was: 3300010401.a:Ga0134121_10001140); c00182_3300010.. (original name was: 3300010401.a:Ga0134121_10006059); c00183_3300010.. (original name was: 3300010401.a:Ga0134121_10000742); c00185_3300010.. (original name was: 3300010401.a:Ga0134121_10000302); c00186_3300010.. (original name was: 3300010401.a:Ga0134121_10000221); c00187_3300010.. (original name was: 3300010401.a:Ga0134121_10000747); c00189_3300010.. (original name was: 3300010401.a:Ga0134121_10000262); c00190_3300010.. (original name was: 3300010401.a:Ga0134121_10003169); c00191_3300010.. (original name was: 3300010401.a:Ga0134121_10000306); c00192_3300010.. (original name was: 3300010401.a:Ga0134121_10003777); c00193_3300010.. (original name was: 3300010401.a:Ga0134121_10000914); c00194_3300010.. (original name was: 3300010401.a:Ga0134121_10000505); c00195_3300010.. (original name was: 3300010401.a:Ga0134121_10000812); c00196_3300010.. (original name was: 3300010401.a:Ga0134121_10000403); c00197_3300010.. (original name was: 3300010401.a:Ga0134121_10034412); c00198_3300010.. (original name was: 3300010401.a:Ga0134121_10000601); c00199_3300010.. (original name was: 3300010401.a:Ga0134121_10000485); c00200_3300010.. (original name was: 3300010401.a:Ga0134121_10003470); c00201_3300010.. (original name was: 3300010401.a:Ga0134121_10020541); c00202_3300010.. (original name was: 3300010401.a:Ga0134121_10001163); c00203_3300010.. (original name was: 3300010401.a:Ga0134121_10000367); c00204_3300010.. (original name was: 3300010401.a:Ga0134121_10024145); c00205_3300010.. (original name was: 3300010401.a:Ga0134121_10000151); c00206_3300010.. (original name was: 3300010401.a:Ga0134121_10000969); c00207_3300010.. (original name was: 3300010401.a:Ga0134121_10000678); c00208_3300010.. (original name was: 3300010401.a:Ga0134121_10040164); c00209_3300010.. (original name was: 3300010401.a:Ga0134121_10000280); c00210_3300010.. (original name was: 3300010401.a:Ga0134121_10000075); c00211_3300010.. (original name was: 3300010401.a:Ga0134121_10000484); c00212_3300010.. (original name was: 3300010401.a:Ga0134121_10000116); c00213_3300010.. (original name was: 3300010401.a:Ga0134121_10004693); c00214_3300010.. (original name was: 3300010401.a:Ga0134121_10019827); c00215_3300010.. (original name was: 3300010401.a:Ga0134121_10000445); c00218_3300010.. (original name was: 3300010401.a:Ga0134121_10000190); c00219_3300010.. (original name was: 3300010401.a:Ga0134121_10000146); c00220_3300010.. (original name was: 3300010401.a:Ga0134121_10001782); c00221_3300010.. (original name was: 3300010401.a:Ga0134121_10001022); c00222_3300010.. (original name was: 3300010401.a:Ga0134121_10000144); c00223_3300010.. (original name was: 3300010401.a:Ga0134121_10006655); c00224_3300010.. (original name was: 3300010401.a:Ga0134121_10001338); c00225_3300010.. (original name was: 3300010401.a:Ga0134121_10000158); c00226_3300010.. (original name was: 3300010401.a:Ga0134121_10000066); c00227_3300010.. (original name was: 3300010401.a:Ga0134121_10023558); c00228_3300010.. (original name was: 3300010401.a:Ga0134121_10001264); c00229_3300010.. (original name was: 3300010401.a:Ga0134121_10004149); c00231_3300010.. (original name was: 3300010401.a:Ga0134121_10000616); c00233_3300010.. (original name was: 3300010401.a:Ga0134121_10000177); c00235_3300010.. (original name was: 3300010401.a:Ga0134121_10000203); c00236_3300010.. (original name was: 3300010401.a:Ga0134121_10000612); c00237_3300010.. (original name was: 3300010401.a:Ga0134121_10000321); c00238_3300010.. (original name was: 3300010401.a:Ga0134121_10002934); c00239_3300010.. (original name was: 3300010401.a:Ga0134121_10001298); c00240_3300010.. (original name was: 3300010401.a:Ga0134121_10006615); c00241_3300010.. (original name was: 3300010401.a:Ga0134121_10000469); c00242_3300010.. (original name was: 3300010401.a:Ga0134121_10000270); c00244_3300010.. (original name was: 3300010401.a:Ga0134121_10002020); c00245_3300010.. (original name was: 3300010401.a:Ga0134121_10002157); c00246_3300010.. (original name was: 3300010401.a:Ga0134121_10000521); c00247_3300010.. (original name was: 3300010401.a:Ga0134121_10000491); c00248_3300010.. (original name was: 3300010401.a:Ga0134121_10000082); c00249_3300010.. (original name was: 3300010401.a:Ga0134121_10006879); c00250_3300010.. (original name was: 3300010401.a:Ga0134121_10000935); c00252_3300010.. (original name was: 3300010401.a:Ga0134121_10003102); c00253_3300010.. (original name was: 3300010401.a:Ga0134121_10000455); c00254_3300010.. (original name was: 3300010401.a:Ga0134121_10002047); c00255_3300010.. (original name was: 3300010401.a:Ga0134121_10062911); c00256_3300010.. (original name was: 3300010401.a:Ga0134121_10000476); c00257_3300010.. (original name was: 3300010401.a:Ga0134121_10002665); c00258_3300010.. (original name was: 3300010401.a:Ga0134121_10013098); c00259_3300010.. (original name was: 3300010401.a:Ga0134121_10009313); c00260_3300010.. (original name was: 3300010401.a:Ga0134121_10018983); c00261_3300010.. (original name was: 3300010401.a:Ga0134121_10000533); c00262_3300010.. (original name was: 3300010401.a:Ga0134121_10011256); c00263_3300010.. (original name was: 3300010401.a:Ga0134121_10015343); c00264_3300010.. (original name was: 3300010401.a:Ga0134121_10007014); c00265_3300010.. (original name was: 3300010401.a:Ga0134121_10000061); c00266_3300010.. (original name was: 3300010401.a:Ga0134121_10001697)

Compact view

c00028_3300010.. - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Location: 1 - 5,824 nt. (total: 5,824 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5824:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg28_1

Search NORINE for peptide: strict or relaxed

AMP-binding (87..488): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpWdFGiIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

PKS_AT (1220..1510): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.4
inactive: 97.0
Methylmalonyl-CoA: 57.9
Methoxymalonyl-CoA: 57.9
Propionyl-CoA: 47.0
Ethylmalonyl-CoA: 30.7
2-Methylbutyryl-CoA: 30.3
Benzoyl-CoA: 27.6
Acetyl-CoA: 26.3
Isobutyryl-CoA: 25.3
CHC-CoA: 21.6
trans-1,2-CPDA: 17.9
fatty_acid: 13.4
3-Methylbutyryl-CoA: 0.0

c00039_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 20,198 nt. (total: 20,198 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 20198:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys) + (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg39_14

Search NORINE for peptide: strict or relaxed

AMP-binding (470..865): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAvWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg39_15

Search NORINE for peptide: strict or relaxed

AMP-binding (0..211): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

c00049_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 3,212 - 25,617 nt. (total: 22,406 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00058_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 89,352 nt. (total: 89,352 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 89352:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - cys) + (gly - gly - gly - cys - thr - ser - leu - val - ser) + (bht - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_8

Search NORINE for peptide: strict or relaxed

CAL_domain (25..478): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 40.9
NH2: 27.8
AHBA: 12.0
shikimic_acid: 0.0
fatty_acid: -3.7

AMP-binding (1151..1598): bht

NRPSPredictor2: bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: bht

Stachelhaus prediction details:

Stachelhaus sequence:: asGsLGGVCK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

PKS_AT (2335..2632): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.0
inactive: 102.0
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 57.4
Propionyl-CoA: 47.5
2-Methylbutyryl-CoA: 36.0
Isobutyryl-CoA: 35.0
fatty_acid: 23.5
CHC-CoA: 21.5
Acetyl-CoA: 15.5
3-Methylbutyryl-CoA: 13.1
Ethylmalonyl-CoA: 12.6
trans-1,2-CPDA: 11.2
Benzoyl-CoA: 10.4

ctg58_18

Search NORINE for peptide: strict or relaxed

AMP-binding (510..902): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIfQiGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

AMP-binding (1579..1971): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2640..3036): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIvQfGLVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (3703..4104): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (4761..5174): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5873..6257): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (6926..7311): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (7977..8388): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (9472..9878): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg58_19

Search NORINE for peptide: strict or relaxed

PKS_AT (533..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 133.2
Methoxymalonyl-CoA: 74.6
inactive: 73.0
Methylmalonyl-CoA: 42.1
Propionyl-CoA: 31.2
Ethylmalonyl-CoA: 27.9
Acetyl-CoA: 17.8
2-Methylbutyryl-CoA: 16.3
CHC-CoA: 15.8
Isobutyryl-CoA: 14.3
3-Methylbutyryl-CoA: 11.2
Benzoyl-CoA: 10.5
fatty_acid: 7.2
trans-1,2-CPDA: 0.0

AMP-binding (1513..1915): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

c00062_3300010.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 36,446 nt. (total: 36,446 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00067_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,936 nt. (total: 4,936 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4936:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg67_1

Search NORINE for peptide: strict or relaxed

AMP-binding (232..609): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (1273..1645): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00068_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 21,163 - 42,548 nt. (total: 21,386 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00073_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,461 nt. (total: 5,461 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00092_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 53,825 nt. (total: 53,825 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 53825:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ohmal) + (mal - X) + (ala - X - ala - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg92_15

Search NORINE for peptide: strict or relaxed

CAL_domain (45..494): pk

minowa: NH2

Prediction, score:

NH2: 203.5
AHBA: 25.0
fatty_acid: 16.6
shikimic_acid: 7.6
Acetyl-CoA: -1.6

AMP-binding (1178..1575): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: asGsLGGVCK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

PKS_AT (2312..2607): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 83.3
Methoxymalonyl-CoA: 76.3
Methylmalonyl-CoA: 67.4
Propionyl-CoA: 44.5
Ethylmalonyl-CoA: 40.0
Isobutyryl-CoA: 37.2
2-Methylbutyryl-CoA: 30.3
trans-1,2-CPDA: 21.5
Benzoyl-CoA: 21.1
fatty_acid: 20.6
Acetyl-CoA: 17.5
CHC-CoA: 17.4
3-Methylbutyryl-CoA: 0.0

ctg92_17

Search NORINE for peptide: strict or relaxed

PKS_AT (539..840): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.5
Methoxymalonyl-CoA: 82.6
Methylmalonyl-CoA: 67.5
inactive: 60.8
Propionyl-CoA: 42.8
Ethylmalonyl-CoA: 35.1
2-Methylbutyryl-CoA: 30.9
fatty_acid: 23.6
CHC-CoA: 20.9
Isobutyryl-CoA: 18.8
trans-1,2-CPDA: 15.8
Benzoyl-CoA: 11.3
Acetyl-CoA: 10.3
3-Methylbutyryl-CoA: 0.0

AMP-binding (1505..1921): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdiGTvtK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 60% (weak)

ctg92_18

Search NORINE for peptide: strict or relaxed

AMP-binding (21..411): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1083..1474): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWfVgAiCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (2140..2531): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3197..3588): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNaALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 90% (moderate)

c00103_3300010.. - Region 1 - T3PKS

Download region GenBank file

Location: 1 - 11,679 nt. (total: 11,679 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00106_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 31,525 nt. (total: 31,525 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 31525:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - leu) + (ala - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg106_15

Search NORINE for peptide: strict or relaxed

CAL_domain (32..472): pk

minowa: NH2

Prediction, score:

NH2: 198.4
Acetyl-CoA: 39.6
AHBA: 25.4
fatty_acid: 23.5
shikimic_acid: 12.3

AMP-binding (1161..1553): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNtnLTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

AMP-binding (2210..2600): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

ctg106_16

Search NORINE for peptide: strict or relaxed

AMP-binding (504..897): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1552..1958): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVpHMSLVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

c00109_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 971 - 68,427 nt. (total: 67,457 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 970 - 68427:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - ala - X - X - X - leu - ile - ala - X) + (mal - gly - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg109_22

Search NORINE for peptide: strict or relaxed

AMP-binding (482..901): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: pAaShvlVgK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 40% (weak)

ctg109_24

CAL_domain (44..489): pk

minowa: NH2

Prediction, score:

NH2: 208.5
fatty_acid: 32.2
Acetyl-CoA: 31.3
AHBA: 8.2
shikimic_acid: 0.0

ctg109_25

Search NORINE for peptide: strict or relaxed

AMP-binding (32..307): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (963..1352): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2588..2976): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVeK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

AMP-binding (3199..3590): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgKDLGlVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

AMP-binding (4248..4653): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DmeDIGgVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (5131..5528): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (6209..6611): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLaVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

AMP-binding (7270..7660): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (8321..8740): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfvfraK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

ctg109_26

Search NORINE for peptide: strict or relaxed

PKS_AT (529..826): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.4
inactive: 120.3
Methylmalonyl-CoA: 66.9
Methoxymalonyl-CoA: 65.8
Propionyl-CoA: 58.1
Ethylmalonyl-CoA: 36.0
2-Methylbutyryl-CoA: 26.8
CHC-CoA: 22.5
Acetyl-CoA: 20.1
Isobutyryl-CoA: 19.4
Benzoyl-CoA: 17.3
trans-1,2-CPDA: 11.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (1495..1872): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (2529..2900): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00120_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,259 nt. (total: 3,259 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3259:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg120_1

Search NORINE for peptide: strict or relaxed

AMP-binding (8..235): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

c00132_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,036 nt. (total: 7,036 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7036:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg132_1

Search NORINE for peptide: strict or relaxed

AMP-binding (955..1341): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00138_3300010.. - Region 1 - terpene

Download region GenBank file

Location: 19,539 - 40,477 nt. (total: 20,939 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00148_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 23,117 nt. (total: 23,117 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 23117:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala) + (D-asn) + (ala) + (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg148_1

Search NORINE for peptide: strict or relaxed

AMP-binding (206..596): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg148_2

Search NORINE for peptide: strict or relaxed

AMP-binding (450..846): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg148_3

Search NORINE for peptide: strict or relaxed

AMP-binding (480..869): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg148_5

Search NORINE for peptide: strict or relaxed

AMP-binding (380..777): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00149_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 22,147 nt. (total: 22,147 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 22147:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg149_13

Search NORINE for peptide: strict or relaxed

CAL_domain (10..337): pk

minowa: NH2

Prediction, score:

NH2: 182.7
Acetyl-CoA: 36.7
fatty_acid: 21.9
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (1013..1410): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAeDdyCisK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 50% (weak)

AMP-binding (2067..2450): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3106..3494): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfWHFgqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00154_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 26,450 - 52,938 nt. (total: 26,489 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00168_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1,654 - 40,172 nt. (total: 38,519 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 1653 - 40172:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg168_24

Search NORINE for peptide: strict or relaxed

AMP-binding (469..865): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEniGTiVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 70% (weak)

ctg168_25

PKS_AT (590..882): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 62.5%; Malonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 117.6
Methoxymalonyl-CoA: 100.9
Ethylmalonyl-CoA: 91.4
Isobutyryl-CoA: 87.5
Propionyl-CoA: 83.5
Acetyl-CoA: 73.6
2-Methylbutyryl-CoA: 71.6
Benzoyl-CoA: 70.2
Malonyl-CoA: 67.9
3-Methylbutyryl-CoA: 66.1
trans-1,2-CPDA: 51.7
CHC-CoA: 43.1
fatty_acid: 33.1
inactive: 18.9

PKS_AT (998..1289): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 138.0
Malonyl-CoA: 109.9
Methoxymalonyl-CoA: 109.1
Isobutyryl-CoA: 105.9
Ethylmalonyl-CoA: 98.6
Propionyl-CoA: 73.9
2-Methylbutyryl-CoA: 71.1
CHC-CoA: 64.5
Benzoyl-CoA: 60.7
trans-1,2-CPDA: 59.5
Acetyl-CoA: 53.4
inactive: 38.0
fatty_acid: 29.8
3-Methylbutyryl-CoA: 23.5

ctg168_26

Search NORINE for peptide: strict or relaxed

AMP-binding (1023..1440): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGaTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

c00172_3300010.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 12,646 - 35,864 nt. (total: 23,219 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg172_12 - Putative Class II

ctg172_18 leader / core peptide: MHKNIDVVRAWRDEEYRNSLTEQDRASLPENPAGVAMVDDSALRTVNGG - AVDhbQHFCGDhbDhbFVDDhaCVKPGQQCP

Lanthipeptide(s) for ctg172_19 - Putative Class II

ctg172_18 leader / core peptide: MHKNIDVVRAWRDEEYRNSLTEQDRASLPENPAGVAMVDDSALRTVNGG - AVDhbQHFCGDhbDhbFVDDhaCVKPGQQCP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg172_18 - Class II

Cleavage pHMM score: -0.10

RODEO score: 0

Monoisotopic mass: 2380.1 Da

Molecular weight: 2381.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2399.7 Da N = 1

ctg172_18 - Class II

Cleavage pHMM score: -0.10

RODEO score: 0

Monoisotopic mass: 2380.1 Da

Molecular weight: 2381.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2399.7 Da N = 1

c00173_3300010.. - Region 1 - T1PKS

Download region GenBank file

Location: 13,102 - 39,114 nt. (total: 26,013 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00184_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 12,742 nt. (total: 12,742 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12742:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg184_1

Search NORINE for peptide: strict or relaxed

AMP-binding (172..584): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (1246..1644): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwyIGesFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

ctg184_3

Search NORINE for peptide: strict or relaxed

AMP-binding (476..870): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

c00188_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 69,600 - 80,547 nt. (total: 10,948 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00216_3300010.. - Region 1 - NRPS

Download region GenBank file

Location: 29,992 - 52,466 nt. (total: 22,475 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00217_3300010.. - Region 1 - ladderane

Download region GenBank file

Location: 1 - 13,690 nt. (total: 13,690 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00230_3300010.. - Region 1 - TfuA-related

Download region GenBank file

Location: 15,268 - 37,932 nt. (total: 22,665 nt) Show pHMM detection rules used

TfuA-related: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00232_3300010.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1,338 - 13,371 nt. (total: 12,034 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00234_3300010.. - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Location: 43,305 - 78,419 nt. (total: 35,115 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 43304 - 78419:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg234_46

CAL_domain (47..492): pk

minowa: NH2

Prediction, score:

NH2: 157.0
AHBA: 20.4
fatty_acid: 18.7
shikimic_acid: 0.9
Acetyl-CoA: -1.6

PKS_AT (1232..1525): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 137.5
Methoxymalonyl-CoA: 119.1
Methylmalonyl-CoA: 114.1
Isobutyryl-CoA: 81.3
Ethylmalonyl-CoA: 70.4
inactive: 66.3
Propionyl-CoA: 63.3
Benzoyl-CoA: 54.5
trans-1,2-CPDA: 45.0
Acetyl-CoA: 40.5
CHC-CoA: 38.7
2-Methylbutyryl-CoA: 36.4
fatty_acid: 26.1
3-Methylbutyryl-CoA: 25.4

c00243_3300010.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 23,371 - 67,203 nt. (total: 43,833 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 23370 - 67203:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - X) + (ohmal) + (gly - val - thr - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg243_42

Search NORINE for peptide: strict or relaxed

AMP-binding (517..909): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DIaQvtLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 70% (weak)

AMP-binding (1562..1939): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (2639..3032): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3695..4177): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: dPRNmVlraK
Nearest Stachelhaus code:: aad
Stachelhaus code match:: 50% (weak)

ctg243_44

PKS_AT (529..832): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 152.5
inactive: 75.9
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 52.2
Isobutyryl-CoA: 38.8
Propionyl-CoA: 25.8
CHC-CoA: 14.9
2-Methylbutyryl-CoA: 13.0
Ethylmalonyl-CoA: 12.1
fatty_acid: 11.2
Benzoyl-CoA: 9.8
3-Methylbutyryl-CoA: 6.8
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0

ctg243_45

Search NORINE for peptide: strict or relaxed

AMP-binding (2..275): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFmAHV-K
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (949..1346): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALfTGqVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

c00251_3300010.. - Region 1 - NRPS-like

Download region GenBank file

Location: 46,696 - 90,733 nt. (total: 44,038 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 46695 - 90733:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg251_59

Search NORINE for peptide: strict or relaxed

AMP-binding (19..418): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsecyGGVtK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)