3300014786_6 - 15 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00044_3300014.. (original name was: 3300014786.a:Ga0169450_109086)

Region	Type	From	To	Most similar known cluster		Similarity
Region 44.1	T1PKS	1	3,677

c00129_3300014.. (original name was: 3300014786.a:Ga0169450_100121)

Region	Type	From	To	Most similar known cluster		Similarity
Region 129.1	NRPS-like	1	22,605

c00142_3300014.. (original name was: 3300014786.a:Ga0169450_103716)

Region	Type	From	To	Most similar known cluster		Similarity
Region 142.1	NRPS	1	7,742

c00158_3300014.. (original name was: 3300014786.a:Ga0169450_101068)

Region	Type	From	To	Most similar known cluster		Similarity
Region 158.1	NRPS-like	1	17,094

c00193_3300014.. (original name was: 3300014786.a:Ga0169450_101826)

Region	Type	From	To	Most similar known cluster		Similarity
Region 193.1	NRPS	1	12,506

c00195_3300014.. (original name was: 3300014786.a:Ga0169450_100515)

Region	Type	From	To	Most similar known cluster		Similarity
Region 195.1	NRPS	1	24,922

c00206_3300014.. (original name was: 3300014786.a:Ga0169450_100368)

Region	Type	From	To	Most similar known cluster		Similarity
Region 206.1	T1PKS,NRPS,lanthipeptide	1	28,585

c00210_3300014.. (original name was: 3300014786.a:Ga0169450_101486)

Region	Type	From	To	Most similar known cluster		Similarity
Region 210.1	NRPS,T1PKS	1	14,200

c00287_3300014.. (original name was: 3300014786.a:Ga0169450_100200)

Region	Type	From	To	Most similar known cluster		Similarity
Region 287.1	NRPS	1	38,521

c00302_3300014.. (original name was: 3300014786.a:Ga0169450_100389)

Region	Type	From	To	Most similar known cluster		Similarity
Region 302.1	terpene	1,154	22,128

c00321_3300014.. (original name was: 3300014786.a:Ga0169450_100474)

Region	Type	From	To	Most similar known cluster		Similarity
Region 321.1	terpene	3,641	25,498

c00327_3300014.. (original name was: 3300014786.a:Ga0169450_100556)

Region	Type	From	To	Most similar known cluster		Similarity
Region 327.1	NRPS-like	1,098	24,059

c00332_3300014.. (original name was: 3300014786.a:Ga0169450_100599)

Region	Type	From	To	Most similar known cluster		Similarity
Region 332.1	T3PKS	1	23,429

c00399_3300014.. (original name was: 3300014786.a:Ga0169450_103386)

Region	Type	From	To	Most similar known cluster		Similarity
Region 399.1	NRPS	1	8,253

c00426_3300014.. (original name was: 3300014786.a:Ga0169450_105786)

Region	Type	From	To	Most similar known cluster		Similarity
Region 426.1	NRPS	1	5,496

Region	Type	From	To	Similarity
Region 44.1	T1PKS	1	3,677
Region 129.1	NRPS-like	1	22,605
Region 142.1	NRPS	1	7,742
Region 158.1	NRPS-like	1	17,094
Region 193.1	NRPS	1	12,506
Region 195.1	NRPS	1	24,922
Region 206.1	T1PKS,NRPS,lanthipeptide	1	28,585
Region 210.1	NRPS,T1PKS	1	14,200
Region 287.1	NRPS	1	38,521
Region 302.1	terpene	1,154	22,128
Region 321.1	terpene	3,641	25,498
Region 327.1	NRPS-like	1,098	24,059
Region 332.1	T3PKS	1	23,429
Region 399.1	NRPS	1	8,253
Region 426.1	NRPS	1	5,496

No secondary metabolite regions were found in these records:: c00001_3300014.. (original name was: 3300014786.a:Ga0169450_111323); c00002_3300014.. (original name was: 3300014786.a:Ga0169450_111183); c00003_3300014.. (original name was: 3300014786.a:Ga0169450_110850); c00004_3300014.. (original name was: 3300014786.a:Ga0169450_110838); c00005_3300014.. (original name was: 3300014786.a:Ga0169450_110814); c00006_3300014.. (original name was: 3300014786.a:Ga0169450_110418); c00007_3300014.. (original name was: 3300014786.a:Ga0169450_110357); c00008_3300014.. (original name was: 3300014786.a:Ga0169450_110119); c00009_3300014.. (original name was: 3300014786.a:Ga0169450_110074); c00010_3300014.. (original name was: 3300014786.a:Ga0169450_110032); c00011_3300014.. (original name was: 3300014786.a:Ga0169450_109982); c00012_3300014.. (original name was: 3300014786.a:Ga0169450_109591); c00013_3300014.. (original name was: 3300014786.a:Ga0169450_109539); c00014_3300014.. (original name was: 3300014786.a:Ga0169450_109483); c00015_3300014.. (original name was: 3300014786.a:Ga0169450_109302); c00016_3300014.. (original name was: 3300014786.a:Ga0169450_109218); c00017_3300014.. (original name was: 3300014786.a:Ga0169450_109214); c00018_3300014.. (original name was: 3300014786.a:Ga0169450_109081); c00019_3300014.. (original name was: 3300014786.a:Ga0169450_109007); c00020_3300014.. (original name was: 3300014786.a:Ga0169450_108844); c00021_3300014.. (original name was: 3300014786.a:Ga0169450_108813); c00022_3300014.. (original name was: 3300014786.a:Ga0169450_108802); c00023_3300014.. (original name was: 3300014786.a:Ga0169450_108660); c00024_3300014.. (original name was: 3300014786.a:Ga0169450_108279); c00025_3300014.. (original name was: 3300014786.a:Ga0169450_108277); c00026_3300014.. (original name was: 3300014786.a:Ga0169450_108011); c00027_3300014.. (original name was: 3300014786.a:Ga0169450_107986); c00028_3300014.. (original name was: 3300014786.a:Ga0169450_110288); c00029_3300014.. (original name was: 3300014786.a:Ga0169450_109586); c00030_3300014.. (original name was: 3300014786.a:Ga0169450_101291); c00031_3300014.. (original name was: 3300014786.a:Ga0169450_109958); c00032_3300014.. (original name was: 3300014786.a:Ga0169450_106572); c00033_3300014.. (original name was: 3300014786.a:Ga0169450_107391); c00034_3300014.. (original name was: 3300014786.a:Ga0169450_109910); c00035_3300014.. (original name was: 3300014786.a:Ga0169450_100798); c00036_3300014.. (original name was: 3300014786.a:Ga0169450_104888); c00037_3300014.. (original name was: 3300014786.a:Ga0169450_109783); c00038_3300014.. (original name was: 3300014786.a:Ga0169450_109547); c00039_3300014.. (original name was: 3300014786.a:Ga0169450_109643); c00040_3300014.. (original name was: 3300014786.a:Ga0169450_104638); c00041_3300014.. (original name was: 3300014786.a:Ga0169450_109374); c00042_3300014.. (original name was: 3300014786.a:Ga0169450_102830); c00043_3300014.. (original name was: 3300014786.a:Ga0169450_109275); c00045_3300014.. (original name was: 3300014786.a:Ga0169450_101610); c00046_3300014.. (original name was: 3300014786.a:Ga0169450_109781); c00047_3300014.. (original name was: 3300014786.a:Ga0169450_108984); c00048_3300014.. (original name was: 3300014786.a:Ga0169450_108438); c00049_3300014.. (original name was: 3300014786.a:Ga0169450_103530); c00050_3300014.. (original name was: 3300014786.a:Ga0169450_110893); c00051_3300014.. (original name was: 3300014786.a:Ga0169450_108380); c00052_3300014.. (original name was: 3300014786.a:Ga0169450_107558); c00053_3300014.. (original name was: 3300014786.a:Ga0169450_107286); c00054_3300014.. (original name was: 3300014786.a:Ga0169450_107178); c00055_3300014.. (original name was: 3300014786.a:Ga0169450_103963); c00056_3300014.. (original name was: 3300014786.a:Ga0169450_108592); c00057_3300014.. (original name was: 3300014786.a:Ga0169450_106881); c00058_3300014.. (original name was: 3300014786.a:Ga0169450_101858); c00059_3300014.. (original name was: 3300014786.a:Ga0169450_101916); c00060_3300014.. (original name was: 3300014786.a:Ga0169450_103577); c00061_3300014.. (original name was: 3300014786.a:Ga0169450_105956); c00062_3300014.. (original name was: 3300014786.a:Ga0169450_100981); c00063_3300014.. (original name was: 3300014786.a:Ga0169450_105853); c00064_3300014.. (original name was: 3300014786.a:Ga0169450_105743); c00065_3300014.. (original name was: 3300014786.a:Ga0169450_105385); c00066_3300014.. (original name was: 3300014786.a:Ga0169450_105301); c00067_3300014.. (original name was: 3300014786.a:Ga0169450_104279); c00068_3300014.. (original name was: 3300014786.a:Ga0169450_108274); c00069_3300014.. (original name was: 3300014786.a:Ga0169450_101757); c00070_3300014.. (original name was: 3300014786.a:Ga0169450_105015); c00071_3300014.. (original name was: 3300014786.a:Ga0169450_104995); c00072_3300014.. (original name was: 3300014786.a:Ga0169450_104827); c00073_3300014.. (original name was: 3300014786.a:Ga0169450_106801); c00074_3300014.. (original name was: 3300014786.a:Ga0169450_101075); c00075_3300014.. (original name was: 3300014786.a:Ga0169450_105050); c00076_3300014.. (original name was: 3300014786.a:Ga0169450_104810); c00077_3300014.. (original name was: 3300014786.a:Ga0169450_108870); c00078_3300014.. (original name was: 3300014786.a:Ga0169450_100707); c00079_3300014.. (original name was: 3300014786.a:Ga0169450_101524); c00080_3300014.. (original name was: 3300014786.a:Ga0169450_102478); c00081_3300014.. (original name was: 3300014786.a:Ga0169450_104159); c00082_3300014.. (original name was: 3300014786.a:Ga0169450_100069); c00083_3300014.. (original name was: 3300014786.a:Ga0169450_103985); c00084_3300014.. (original name was: 3300014786.a:Ga0169450_101416); c00085_3300014.. (original name was: 3300014786.a:Ga0169450_103877); c00086_3300014.. (original name was: 3300014786.a:Ga0169450_103864); c00087_3300014.. (original name was: 3300014786.a:Ga0169450_108603); c00088_3300014.. (original name was: 3300014786.a:Ga0169450_107023); c00089_3300014.. (original name was: 3300014786.a:Ga0169450_107813); c00090_3300014.. (original name was: 3300014786.a:Ga0169450_101155); c00091_3300014.. (original name was: 3300014786.a:Ga0169450_103790); c00092_3300014.. (original name was: 3300014786.a:Ga0169450_106968); c00093_3300014.. (original name was: 3300014786.a:Ga0169450_111004); c00094_3300014.. (original name was: 3300014786.a:Ga0169450_101128); c00095_3300014.. (original name was: 3300014786.a:Ga0169450_100398); c00096_3300014.. (original name was: 3300014786.a:Ga0169450_103572); c00097_3300014.. (original name was: 3300014786.a:Ga0169450_100187); c00098_3300014.. (original name was: 3300014786.a:Ga0169450_105918); c00099_3300014.. (original name was: 3300014786.a:Ga0169450_103516); c00100_3300014.. (original name was: 3300014786.a:Ga0169450_103857); c00101_3300014.. (original name was: 3300014786.a:Ga0169450_103459); c00102_3300014.. (original name was: 3300014786.a:Ga0169450_105325); c00103_3300014.. (original name was: 3300014786.a:Ga0169450_105776); c00104_3300014.. (original name was: 3300014786.a:Ga0169450_104131); c00105_3300014.. (original name was: 3300014786.a:Ga0169450_102494); c00106_3300014.. (original name was: 3300014786.a:Ga0169450_103334); c00107_3300014.. (original name was: 3300014786.a:Ga0169450_107311); c00108_3300014.. (original name was: 3300014786.a:Ga0169450_109253); c00109_3300014.. (original name was: 3300014786.a:Ga0169450_100254); c00110_3300014.. (original name was: 3300014786.a:Ga0169450_107660); c00111_3300014.. (original name was: 3300014786.a:Ga0169450_101116); c00112_3300014.. (original name was: 3300014786.a:Ga0169450_104275); c00113_3300014.. (original name was: 3300014786.a:Ga0169450_103282); c00114_3300014.. (original name was: 3300014786.a:Ga0169450_101581); c00115_3300014.. (original name was: 3300014786.a:Ga0169450_100648); c00116_3300014.. (original name was: 3300014786.a:Ga0169450_103163); c00117_3300014.. (original name was: 3300014786.a:Ga0169450_103785); c00118_3300014.. (original name was: 3300014786.a:Ga0169450_100492); c00119_3300014.. (original name was: 3300014786.a:Ga0169450_102833); c00120_3300014.. (original name was: 3300014786.a:Ga0169450_101066); c00121_3300014.. (original name was: 3300014786.a:Ga0169450_102589); c00122_3300014.. (original name was: 3300014786.a:Ga0169450_105150); c00123_3300014.. (original name was: 3300014786.a:Ga0169450_104369); c00124_3300014.. (original name was: 3300014786.a:Ga0169450_107594); c00125_3300014.. (original name was: 3300014786.a:Ga0169450_109240); c00126_3300014.. (original name was: 3300014786.a:Ga0169450_101170); c00127_3300014.. (original name was: 3300014786.a:Ga0169450_102594); c00128_3300014.. (original name was: 3300014786.a:Ga0169450_100883); c00130_3300014.. (original name was: 3300014786.a:Ga0169450_101766); c00131_3300014.. (original name was: 3300014786.a:Ga0169450_101701); c00132_3300014.. (original name was: 3300014786.a:Ga0169450_100278); c00133_3300014.. (original name was: 3300014786.a:Ga0169450_102733); c00134_3300014.. (original name was: 3300014786.a:Ga0169450_101248); c00135_3300014.. (original name was: 3300014786.a:Ga0169450_100316); c00136_3300014.. (original name was: 3300014786.a:Ga0169450_102412); c00137_3300014.. (original name was: 3300014786.a:Ga0169450_102701); c00138_3300014.. (original name was: 3300014786.a:Ga0169450_100803); c00139_3300014.. (original name was: 3300014786.a:Ga0169450_101506); c00140_3300014.. (original name was: 3300014786.a:Ga0169450_103325); c00141_3300014.. (original name was: 3300014786.a:Ga0169450_100539); c00143_3300014.. (original name was: 3300014786.a:Ga0169450_105363); c00144_3300014.. (original name was: 3300014786.a:Ga0169450_101505); c00145_3300014.. (original name was: 3300014786.a:Ga0169450_103141); c00146_3300014.. (original name was: 3300014786.a:Ga0169450_110826); c00147_3300014.. (original name was: 3300014786.a:Ga0169450_105888); c00148_3300014.. (original name was: 3300014786.a:Ga0169450_104956); c00149_3300014.. (original name was: 3300014786.a:Ga0169450_106441); c00150_3300014.. (original name was: 3300014786.a:Ga0169450_101418); c00151_3300014.. (original name was: 3300014786.a:Ga0169450_103491); c00152_3300014.. (original name was: 3300014786.a:Ga0169450_104062); c00153_3300014.. (original name was: 3300014786.a:Ga0169450_100704); c00154_3300014.. (original name was: 3300014786.a:Ga0169450_101523); c00155_3300014.. (original name was: 3300014786.a:Ga0169450_103457); c00156_3300014.. (original name was: 3300014786.a:Ga0169450_110819); c00157_3300014.. (original name was: 3300014786.a:Ga0169450_104426); c00159_3300014.. (original name was: 3300014786.a:Ga0169450_101773); c00160_3300014.. (original name was: 3300014786.a:Ga0169450_100484); c00161_3300014.. (original name was: 3300014786.a:Ga0169450_102243); c00162_3300014.. (original name was: 3300014786.a:Ga0169450_107854); c00163_3300014.. (original name was: 3300014786.a:Ga0169450_101110); c00164_3300014.. (original name was: 3300014786.a:Ga0169450_100265); c00165_3300014.. (original name was: 3300014786.a:Ga0169450_109099); c00166_3300014.. (original name was: 3300014786.a:Ga0169450_100342); c00167_3300014.. (original name was: 3300014786.a:Ga0169450_110234); c00168_3300014.. (original name was: 3300014786.a:Ga0169450_108589); c00169_3300014.. (original name was: 3300014786.a:Ga0169450_108522); c00170_3300014.. (original name was: 3300014786.a:Ga0169450_100926); c00171_3300014.. (original name was: 3300014786.a:Ga0169450_102573); c00172_3300014.. (original name was: 3300014786.a:Ga0169450_107029); c00173_3300014.. (original name was: 3300014786.a:Ga0169450_100379); c00174_3300014.. (original name was: 3300014786.a:Ga0169450_100470); c00175_3300014.. (original name was: 3300014786.a:Ga0169450_101109); c00176_3300014.. (original name was: 3300014786.a:Ga0169450_101175); c00177_3300014.. (original name was: 3300014786.a:Ga0169450_110086); c00178_3300014.. (original name was: 3300014786.a:Ga0169450_108096); c00179_3300014.. (original name was: 3300014786.a:Ga0169450_101986); c00180_3300014.. (original name was: 3300014786.a:Ga0169450_106034); c00181_3300014.. (original name was: 3300014786.a:Ga0169450_100861); c00182_3300014.. (original name was: 3300014786.a:Ga0169450_101564); c00183_3300014.. (original name was: 3300014786.a:Ga0169450_100557); c00184_3300014.. (original name was: 3300014786.a:Ga0169450_105527); c00185_3300014.. (original name was: 3300014786.a:Ga0169450_103073); c00186_3300014.. (original name was: 3300014786.a:Ga0169450_100751); c00187_3300014.. (original name was: 3300014786.a:Ga0169450_107180); c00188_3300014.. (original name was: 3300014786.a:Ga0169450_100092); c00189_3300014.. (original name was: 3300014786.a:Ga0169450_101494); c00190_3300014.. (original name was: 3300014786.a:Ga0169450_104720); c00191_3300014.. (original name was: 3300014786.a:Ga0169450_103140); c00192_3300014.. (original name was: 3300014786.a:Ga0169450_100469); c00194_3300014.. (original name was: 3300014786.a:Ga0169450_100797); c00196_3300014.. (original name was: 3300014786.a:Ga0169450_106067); c00197_3300014.. (original name was: 3300014786.a:Ga0169450_100646); c00198_3300014.. (original name was: 3300014786.a:Ga0169450_101484); c00199_3300014.. (original name was: 3300014786.a:Ga0169450_101057); c00200_3300014.. (original name was: 3300014786.a:Ga0169450_103102); c00201_3300014.. (original name was: 3300014786.a:Ga0169450_109620); c00202_3300014.. (original name was: 3300014786.a:Ga0169450_101222); c00203_3300014.. (original name was: 3300014786.a:Ga0169450_101387); c00204_3300014.. (original name was: 3300014786.a:Ga0169450_103172); c00205_3300014.. (original name was: 3300014786.a:Ga0169450_102929); c00207_3300014.. (original name was: 3300014786.a:Ga0169450_107018); c00208_3300014.. (original name was: 3300014786.a:Ga0169450_104759); c00209_3300014.. (original name was: 3300014786.a:Ga0169450_104844); c00211_3300014.. (original name was: 3300014786.a:Ga0169450_104644); c00212_3300014.. (original name was: 3300014786.a:Ga0169450_101574); c00213_3300014.. (original name was: 3300014786.a:Ga0169450_106369); c00214_3300014.. (original name was: 3300014786.a:Ga0169450_101769); c00215_3300014.. (original name was: 3300014786.a:Ga0169450_100771); c00216_3300014.. (original name was: 3300014786.a:Ga0169450_100837); c00217_3300014.. (original name was: 3300014786.a:Ga0169450_101147); c00218_3300014.. (original name was: 3300014786.a:Ga0169450_100748); c00219_3300014.. (original name was: 3300014786.a:Ga0169450_102739); c00220_3300014.. (original name was: 3300014786.a:Ga0169450_101631); c00221_3300014.. (original name was: 3300014786.a:Ga0169450_103142); c00222_3300014.. (original name was: 3300014786.a:Ga0169450_104789); c00223_3300014.. (original name was: 3300014786.a:Ga0169450_102849); c00224_3300014.. (original name was: 3300014786.a:Ga0169450_100280); c00225_3300014.. (original name was: 3300014786.a:Ga0169450_105143); c00226_3300014.. (original name was: 3300014786.a:Ga0169450_101917); c00227_3300014.. (original name was: 3300014786.a:Ga0169450_101655); c00228_3300014.. (original name was: 3300014786.a:Ga0169450_101734); c00229_3300014.. (original name was: 3300014786.a:Ga0169450_101621); c00230_3300014.. (original name was: 3300014786.a:Ga0169450_110052); c00231_3300014.. (original name was: 3300014786.a:Ga0169450_101756); c00232_3300014.. (original name was: 3300014786.a:Ga0169450_108546); c00233_3300014.. (original name was: 3300014786.a:Ga0169450_102484); c00234_3300014.. (original name was: 3300014786.a:Ga0169450_104268); c00235_3300014.. (original name was: 3300014786.a:Ga0169450_102557); c00236_3300014.. (original name was: 3300014786.a:Ga0169450_105668); c00237_3300014.. (original name was: 3300014786.a:Ga0169450_102442); c00238_3300014.. (original name was: 3300014786.a:Ga0169450_104897); c00239_3300014.. (original name was: 3300014786.a:Ga0169450_100137); c00240_3300014.. (original name was: 3300014786.a:Ga0169450_101783); c00241_3300014.. (original name was: 3300014786.a:Ga0169450_100977); c00242_3300014.. (original name was: 3300014786.a:Ga0169450_102171); c00243_3300014.. (original name was: 3300014786.a:Ga0169450_104509); c00244_3300014.. (original name was: 3300014786.a:Ga0169450_101150); c00245_3300014.. (original name was: 3300014786.a:Ga0169450_106692); c00246_3300014.. (original name was: 3300014786.a:Ga0169450_101411); c00247_3300014.. (original name was: 3300014786.a:Ga0169450_104702); c00248_3300014.. (original name was: 3300014786.a:Ga0169450_102134); c00249_3300014.. (original name was: 3300014786.a:Ga0169450_100324); c00250_3300014.. (original name was: 3300014786.a:Ga0169450_102498); c00251_3300014.. (original name was: 3300014786.a:Ga0169450_100739); c00252_3300014.. (original name was: 3300014786.a:Ga0169450_110229); c00253_3300014.. (original name was: 3300014786.a:Ga0169450_108583); c00254_3300014.. (original name was: 3300014786.a:Ga0169450_101932); c00255_3300014.. (original name was: 3300014786.a:Ga0169450_103719); c00256_3300014.. (original name was: 3300014786.a:Ga0169450_102007); c00257_3300014.. (original name was: 3300014786.a:Ga0169450_105719); c00258_3300014.. (original name was: 3300014786.a:Ga0169450_100715); c00259_3300014.. (original name was: 3300014786.a:Ga0169450_102360); c00260_3300014.. (original name was: 3300014786.a:Ga0169450_101952); c00261_3300014.. (original name was: 3300014786.a:Ga0169450_110831); c00262_3300014.. (original name was: 3300014786.a:Ga0169450_101021); c00263_3300014.. (original name was: 3300014786.a:Ga0169450_101838); c00264_3300014.. (original name was: 3300014786.a:Ga0169450_102748); c00265_3300014.. (original name was: 3300014786.a:Ga0169450_109492); c00266_3300014.. (original name was: 3300014786.a:Ga0169450_111072); c00267_3300014.. (original name was: 3300014786.a:Ga0169450_100325); c00268_3300014.. (original name was: 3300014786.a:Ga0169450_100679); c00269_3300014.. (original name was: 3300014786.a:Ga0169450_102490); c00270_3300014.. (original name was: 3300014786.a:Ga0169450_100721); c00271_3300014.. (original name was: 3300014786.a:Ga0169450_104013); c00272_3300014.. (original name was: 3300014786.a:Ga0169450_102681); c00273_3300014.. (original name was: 3300014786.a:Ga0169450_101420); c00274_3300014.. (original name was: 3300014786.a:Ga0169450_108005); c00275_3300014.. (original name was: 3300014786.a:Ga0169450_110538); c00276_3300014.. (original name was: 3300014786.a:Ga0169450_109061); c00277_3300014.. (original name was: 3300014786.a:Ga0169450_110640); c00278_3300014.. (original name was: 3300014786.a:Ga0169450_109682); c00279_3300014.. (original name was: 3300014786.a:Ga0169450_103164); c00280_3300014.. (original name was: 3300014786.a:Ga0169450_111159); c00281_3300014.. (original name was: 3300014786.a:Ga0169450_100059); c00282_3300014.. (original name was: 3300014786.a:Ga0169450_100912); c00283_3300014.. (original name was: 3300014786.a:Ga0169450_103323); c00284_3300014.. (original name was: 3300014786.a:Ga0169450_100097); c00285_3300014.. (original name was: 3300014786.a:Ga0169450_100138); c00286_3300014.. (original name was: 3300014786.a:Ga0169450_101781); c00288_3300014.. (original name was: 3300014786.a:Ga0169450_100204); c00289_3300014.. (original name was: 3300014786.a:Ga0169450_100220); c00290_3300014.. (original name was: 3300014786.a:Ga0169450_108423); c00291_3300014.. (original name was: 3300014786.a:Ga0169450_100259); c00292_3300014.. (original name was: 3300014786.a:Ga0169450_107574); c00293_3300014.. (original name was: 3300014786.a:Ga0169450_104349); c00294_3300014.. (original name was: 3300014786.a:Ga0169450_106825); c00295_3300014.. (original name was: 3300014786.a:Ga0169450_100241); c00296_3300014.. (original name was: 3300014786.a:Ga0169450_100307); c00297_3300014.. (original name was: 3300014786.a:Ga0169450_104396); c00298_3300014.. (original name was: 3300014786.a:Ga0169450_105211); c00299_3300014.. (original name was: 3300014786.a:Ga0169450_100338); c00300_3300014.. (original name was: 3300014786.a:Ga0169450_100302); c00301_3300014.. (original name was: 3300014786.a:Ga0169450_100369); c00303_3300014.. (original name was: 3300014786.a:Ga0169450_100413); c00304_3300014.. (original name was: 3300014786.a:Ga0169450_100468); c00305_3300014.. (original name was: 3300014786.a:Ga0169450_107028); c00306_3300014.. (original name was: 3300014786.a:Ga0169450_102090); c00307_3300014.. (original name was: 3300014786.a:Ga0169450_108674); c00308_3300014.. (original name was: 3300014786.a:Ga0169450_100510); c00309_3300014.. (original name was: 3300014786.a:Ga0169450_109559); c00310_3300014.. (original name was: 3300014786.a:Ga0169450_101328); c00311_3300014.. (original name was: 3300014786.a:Ga0169450_103745); c00312_3300014.. (original name was: 3300014786.a:Ga0169450_100518); c00313_3300014.. (original name was: 3300014786.a:Ga0169450_110407); c00314_3300014.. (original name was: 3300014786.a:Ga0169450_100465); c00315_3300014.. (original name was: 3300014786.a:Ga0169450_100530); c00316_3300014.. (original name was: 3300014786.a:Ga0169450_106257); c00317_3300014.. (original name was: 3300014786.a:Ga0169450_100538); c00318_3300014.. (original name was: 3300014786.a:Ga0169450_100463); c00319_3300014.. (original name was: 3300014786.a:Ga0169450_102174); c00320_3300014.. (original name was: 3300014786.a:Ga0169450_106264); c00322_3300014.. (original name was: 3300014786.a:Ga0169450_100541); c00323_3300014.. (original name was: 3300014786.a:Ga0169450_102985); c00324_3300014.. (original name was: 3300014786.a:Ga0169450_104631); c00325_3300014.. (original name was: 3300014786.a:Ga0169450_108787); c00326_3300014.. (original name was: 3300014786.a:Ga0169450_103849); c00328_3300014.. (original name was: 3300014786.a:Ga0169450_102208); c00329_3300014.. (original name was: 3300014786.a:Ga0169450_100563); c00330_3300014.. (original name was: 3300014786.a:Ga0169450_107106); c00331_3300014.. (original name was: 3300014786.a:Ga0169450_100619); c00333_3300014.. (original name was: 3300014786.a:Ga0169450_100664); c00334_3300014.. (original name was: 3300014786.a:Ga0169450_102344); c00335_3300014.. (original name was: 3300014786.a:Ga0169450_100765); c00336_3300014.. (original name was: 3300014786.a:Ga0169450_103218); c00337_3300014.. (original name was: 3300014786.a:Ga0169450_100787); c00338_3300014.. (original name was: 3300014786.a:Ga0169450_100789); c00339_3300014.. (original name was: 3300014786.a:Ga0169450_100794); c00340_3300014.. (original name was: 3300014786.a:Ga0169450_100800); c00341_3300014.. (original name was: 3300014786.a:Ga0169450_100893); c00342_3300014.. (original name was: 3300014786.a:Ga0169450_100925); c00343_3300014.. (original name was: 3300014786.a:Ga0169450_101069); c00344_3300014.. (original name was: 3300014786.a:Ga0169450_101887); c00345_3300014.. (original name was: 3300014786.a:Ga0169450_101090); c00346_3300014.. (original name was: 3300014786.a:Ga0169450_105999); c00347_3300014.. (original name was: 3300014786.a:Ga0169450_104377); c00348_3300014.. (original name was: 3300014786.a:Ga0169450_101151); c00349_3300014.. (original name was: 3300014786.a:Ga0169450_101209); c00350_3300014.. (original name was: 3300014786.a:Ga0169450_101414); c00351_3300014.. (original name was: 3300014786.a:Ga0169450_102233); c00352_3300014.. (original name was: 3300014786.a:Ga0169450_101406); c00353_3300014.. (original name was: 3300014786.a:Ga0169450_101472); c00354_3300014.. (original name was: 3300014786.a:Ga0169450_102271); c00355_3300014.. (original name was: 3300014786.a:Ga0169450_105562); c00356_3300014.. (original name was: 3300014786.a:Ga0169450_108097); c00357_3300014.. (original name was: 3300014786.a:Ga0169450_101513); c00358_3300014.. (original name was: 3300014786.a:Ga0169450_103966); c00359_3300014.. (original name was: 3300014786.a:Ga0169450_106508); c00360_3300014.. (original name was: 3300014786.a:Ga0169450_103217); c00361_3300014.. (original name was: 3300014786.a:Ga0169450_101636); c00362_3300014.. (original name was: 3300014786.a:Ga0169450_101700); c00363_3300014.. (original name was: 3300014786.a:Ga0169450_101829); c00364_3300014.. (original name was: 3300014786.a:Ga0169450_101870); c00365_3300014.. (original name was: 3300014786.a:Ga0169450_101806); c00366_3300014.. (original name was: 3300014786.a:Ga0169450_101872); c00367_3300014.. (original name was: 3300014786.a:Ga0169450_101919); c00368_3300014.. (original name was: 3300014786.a:Ga0169450_102011); c00369_3300014.. (original name was: 3300014786.a:Ga0169450_102062); c00370_3300014.. (original name was: 3300014786.a:Ga0169450_104516); c00371_3300014.. (original name was: 3300014786.a:Ga0169450_102093); c00372_3300014.. (original name was: 3300014786.a:Ga0169450_101178); c00373_3300014.. (original name was: 3300014786.a:Ga0169450_106183); c00374_3300014.. (original name was: 3300014786.a:Ga0169450_102220); c00375_3300014.. (original name was: 3300014786.a:Ga0169450_103833); c00376_3300014.. (original name was: 3300014786.a:Ga0169450_102253); c00377_3300014.. (original name was: 3300014786.a:Ga0169450_102576); c00378_3300014.. (original name was: 3300014786.a:Ga0169450_102600); c00379_3300014.. (original name was: 3300014786.a:Ga0169450_102749); c00380_3300014.. (original name was: 3300014786.a:Ga0169450_102907); c00381_3300014.. (original name was: 3300014786.a:Ga0169450_102912); c00382_3300014.. (original name was: 3300014786.a:Ga0169450_104549); c00383_3300014.. (original name was: 3300014786.a:Ga0169450_106144); c00384_3300014.. (original name was: 3300014786.a:Ga0169450_102918); c00385_3300014.. (original name was: 3300014786.a:Ga0169450_102921); c00386_3300014.. (original name was: 3300014786.a:Ga0169450_105309); c00387_3300014.. (original name was: 3300014786.a:Ga0169450_111090); c00388_3300014.. (original name was: 3300014786.a:Ga0169450_102927); c00389_3300014.. (original name was: 3300014786.a:Ga0169450_103001); c00390_3300014.. (original name was: 3300014786.a:Ga0169450_102152); c00391_3300014.. (original name was: 3300014786.a:Ga0169450_107090); c00392_3300014.. (original name was: 3300014786.a:Ga0169450_107938); c00393_3300014.. (original name was: 3300014786.a:Ga0169450_103067); c00394_3300014.. (original name was: 3300014786.a:Ga0169450_103819); c00395_3300014.. (original name was: 3300014786.a:Ga0169450_103885); c00396_3300014.. (original name was: 3300014786.a:Ga0169450_103274); c00397_3300014.. (original name was: 3300014786.a:Ga0169450_103382); c00398_3300014.. (original name was: 3300014786.a:Ga0169450_100095); c00400_3300014.. (original name was: 3300014786.a:Ga0169450_103779); c00401_3300014.. (original name was: 3300014786.a:Ga0169450_104596); c00402_3300014.. (original name was: 3300014786.a:Ga0169450_103795); c00403_3300014.. (original name was: 3300014786.a:Ga0169450_103809); c00404_3300014.. (original name was: 3300014786.a:Ga0169450_102350); c00405_3300014.. (original name was: 3300014786.a:Ga0169450_103997); c00406_3300014.. (original name was: 3300014786.a:Ga0169450_110571); c00407_3300014.. (original name was: 3300014786.a:Ga0169450_105632); c00408_3300014.. (original name was: 3300014786.a:Ga0169450_105750); c00409_3300014.. (original name was: 3300014786.a:Ga0169450_104170); c00410_3300014.. (original name was: 3300014786.a:Ga0169450_104657); c00411_3300014.. (original name was: 3300014786.a:Ga0169450_104693); c00412_3300014.. (original name was: 3300014786.a:Ga0169450_104783); c00413_3300014.. (original name was: 3300014786.a:Ga0169450_104881); c00414_3300014.. (original name was: 3300014786.a:Ga0169450_104947); c00415_3300014.. (original name was: 3300014786.a:Ga0169450_106662); c00416_3300014.. (original name was: 3300014786.a:Ga0169450_105016); c00417_3300014.. (original name was: 3300014786.a:Ga0169450_101903); c00418_3300014.. (original name was: 3300014786.a:Ga0169450_105261); c00419_3300014.. (original name was: 3300014786.a:Ga0169450_100356); c00420_3300014.. (original name was: 3300014786.a:Ga0169450_105294); c00421_3300014.. (original name was: 3300014786.a:Ga0169450_100438); c00422_3300014.. (original name was: 3300014786.a:Ga0169450_105443); c00423_3300014.. (original name was: 3300014786.a:Ga0169450_105582); c00424_3300014.. (original name was: 3300014786.a:Ga0169450_105692); c00425_3300014.. (original name was: 3300014786.a:Ga0169450_102429); c00427_3300014.. (original name was: 3300014786.a:Ga0169450_101229); c00428_3300014.. (original name was: 3300014786.a:Ga0169450_106167); c00429_3300014.. (original name was: 3300014786.a:Ga0169450_106176); c00430_3300014.. (original name was: 3300014786.a:Ga0169450_109530); c00431_3300014.. (original name was: 3300014786.a:Ga0169450_106305); c00432_3300014.. (original name was: 3300014786.a:Ga0169450_103094); c00433_3300014.. (original name was: 3300014786.a:Ga0169450_106387); c00434_3300014.. (original name was: 3300014786.a:Ga0169450_106611); c00435_3300014.. (original name was: 3300014786.a:Ga0169450_106546); c00436_3300014.. (original name was: 3300014786.a:Ga0169450_103255); c00437_3300014.. (original name was: 3300014786.a:Ga0169450_108345); c00438_3300014.. (original name was: 3300014786.a:Ga0169450_106699); c00439_3300014.. (original name was: 3300014786.a:Ga0169450_107027); c00440_3300014.. (original name was: 3300014786.a:Ga0169450_107056); c00441_3300014.. (original name was: 3300014786.a:Ga0169450_102527); c00442_3300014.. (original name was: 3300014786.a:Ga0169450_107465); c00443_3300014.. (original name was: 3300014786.a:Ga0169450_106082); c00444_3300014.. (original name was: 3300014786.a:Ga0169450_107728)

Compact view

c00044_3300014.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 3,677 nt. (total: 3,677 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00129_3300014.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 22,605 nt. (total: 22,605 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00142_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,742 nt. (total: 7,742 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7742:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg142_3

Search NORINE for peptide: strict or relaxed

AMP-binding (507..910): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIahVsK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 70% (weak)

c00158_3300014.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 17,094 nt. (total: 17,094 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00193_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 12,506 nt. (total: 12,506 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12506:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg193_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..306): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg193_4

Search NORINE for peptide: strict or relaxed

AMP-binding (35..320): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWxLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

c00195_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 24,922 nt. (total: 24,922 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24922:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg195_12

Search NORINE for peptide: strict or relaxed

AMP-binding (40..437): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1109..1504): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVYyLGgiCK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg195_14

Search NORINE for peptide: strict or relaxed

AMP-binding (216..512): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLknFgT--K
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

c00206_3300014.. - Region 1 - NRPS,T1PKS,lanthipeptide

Download region GenBank file

Location: 1 - 28,585 nt. (total: 28,585 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptide(s) for ctg206_9 - Putative Class II

ctg206_7 leader / core peptide: MMHTINYELIIGSVELSDEELEVVSAG - ADhbAKDhaYDhaCDhbIDhaRDhaDhbKECECDhbCPPREN
allorf_14341_14508 leader / core peptide: MIEQNTIIGS - LELDhaDEELEVVDhaAGKEKKDhaYDhaCDhbVDhaRGDGGCNCDhbCDhaDhaDhaADhbPDhaQNA
allorf_14548_14715 leader / core peptide: MLNIDLNTVVGS - LELDhaDEELEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIPC
allorf_14709_14885 leader / core peptide: MLNIDLNTVVGS - LELDhaDEELEIVDhaAGAEKKDhaYDhaCDhbVDhaRGDGACDhbCDhbCGDhaDhaPDhbPPADhbPH
allorf_15270_15425 leader / core peptide: MQRFGKSLSGSATGMAGA - MNDhaDIHCDhaNQHLRGLPNPDhbDhbLQRLEDhaADhaHWPDH
allorf_19733_19933 leader / core peptide: MTVLSNHDEQSALLAHLLEHNPVGTAELSDDDLELCIGGTAYAGKRSPGCVTMVGG - ECCEIQLDDhbK
allorf_24368_24574 leader / core peptide: VSRCCPYDGMAISLHGWPILPCDRLKSIAGS - GLMANNDhaAQPILNCDhaANCDGCGLADhaVARWWMPIHCWH
allorf_09882_09986 leader / core peptide: LDALSAIAYP - KDhbRVGNALWLPNDhaLIGYDhaADhaVPDhbC
allorf_15292_15381 leader / core peptide: LLDWEARASAGW - DhaNGCRDhaDhaDhaLQPFPWLNH
allorf_15515_15715 leader / core peptide: LLRGKLILGEALGKPIAILEGRLRPPAVKTSLIGSIQRLITALLHMHAA - HCQGERRDhbPDhbKLLVCCH

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

ctg206_7 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 2720.3 Da

Molecular weight: 2722.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2740.0 Da N = 1; 2758.1 Da N = 2; 2776.1 Da N = 3; 2794.1 Da N = 4

allorf_14341_14508 - Class II

Cleavage pHMM score: 1.00

RODEO score: 0

Monoisotopic mass: 4410.0 Da

Molecular weight: 4412.7 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 4430.7 Da N = 1; 4448.8 Da N = 2; 4466.8 Da N = 3; 4484.8 Da N = 4; 4502.8 Da N = 5; 4520.8 Da N = 6; 4538.9 Da N = 7; 4556.9 Da N = 8

allorf_14548_14715 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 1467.7 Da

Molecular weight: 1468.6 Da

Number of bridges: 1

allorf_14709_14885 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 4467.1 Da

Molecular weight: 4469.9 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 4487.9 Da N = 1; 4505.9 Da N = 2; 4523.9 Da N = 3; 4541.9 Da N = 4; 4560.0 Da N = 5; 4578.0 Da N = 6; 4596.0 Da N = 7; 4614.0 Da N = 8

allorf_15270_15425 - Class II

Cleavage pHMM score: -3.60

RODEO score: 0

Monoisotopic mass: 3682.8 Da

Molecular weight: 3685.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3703.0 Da N = 1; 3721.0 Da N = 2; 3739.1 Da N = 3; 3757.1 Da N = 4; 3775.1 Da N = 5

allorf_19733_19933 - Class II

Cleavage pHMM score: -4.00

RODEO score: 0

Monoisotopic mass: 1162.5 Da

Molecular weight: 1163.3 Da

Number of bridges: 1

allorf_24368_24574 - Class II

Cleavage pHMM score: 0.50

RODEO score: 0

Monoisotopic mass: 3971.8 Da

Molecular weight: 3974.6 Da

Number of bridges: 3

allorf_09882_09986 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 2456.3 Da

Molecular weight: 2457.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2475.8 Da N = 1; 2493.9 Da N = 2; 2511.9 Da N = 3; 2529.9 Da N = 4

allorf_15292_15381 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 1856.9 Da

Molecular weight: 1858.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1876.0 Da N = 1; 1894.1 Da N = 2; 1912.1 Da N = 3

allorf_15515_15715 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 1944.0 Da

Molecular weight: 1945.3 Da

Number of bridges: 2

Predicted core structure(s)

For candidate cluster 1, location 0 - 28585:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg206_1

Search NORINE for peptide: strict or relaxed

AMP-binding (507..736): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIF------K
Nearest Stachelhaus code:: phg
Stachelhaus code match:: 40% (weak)

ctg206_2

PKS_AT (614..912): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 66.7%; CE-Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 120.0
Malonyl-CoA: 109.3
Methoxymalonyl-CoA: 98.8
Isobutyryl-CoA: 94.7
Ethylmalonyl-CoA: 88.9
Benzoyl-CoA: 81.8
Propionyl-CoA: 65.2
trans-1,2-CPDA: 52.4
2-Methylbutyryl-CoA: 52.1
Acetyl-CoA: 49.5
3-Methylbutyryl-CoA: 47.8
CHC-CoA: 43.4
inactive: 41.9
fatty_acid: 23.4

c00210_3300014.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 14,200 nt. (total: 14,200 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 14200:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg210_4

PKS_AT (534..826): mal

ATSignature: 2-Rhyd-Malonyl-CoA, Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 62.5%; Malonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.0
inactive: 86.6
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 40.9
Ethylmalonyl-CoA: 36.2
Propionyl-CoA: 30.4
2-Methylbutyryl-CoA: 22.5
Isobutyryl-CoA: 21.9
Benzoyl-CoA: 21.8
fatty_acid: 15.1
CHC-CoA: 11.6
trans-1,2-CPDA: 8.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg210_5

Search NORINE for peptide: strict or relaxed

AMP-binding (506..900): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

ctg210_6

CAL_domain (296..733): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 24.2
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

c00287_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 38,521 nt. (total: 38,521 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38521:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - gly) + (X) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg287_1

Search NORINE for peptide: strict or relaxed

AMP-binding (11..422): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg287_2

Search NORINE for peptide: strict or relaxed

AMP-binding (245..646): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg287_4

Search NORINE for peptide: strict or relaxed

AMP-binding (125..521): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeLtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

ctg287_28

Search NORINE for peptide: strict or relaxed

AMP-binding (95..487): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLvAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

ctg287_31

Search NORINE for peptide: strict or relaxed

AMP-binding (435..832): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg287_33

Search NORINE for peptide: strict or relaxed

AMP-binding (103..502): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1195..1583): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00302_3300014.. - Region 1 - terpene

Download region GenBank file

Location: 1,154 - 22,128 nt. (total: 20,975 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00321_3300014.. - Region 1 - terpene

Download region GenBank file

Location: 3,641 - 25,498 nt. (total: 21,858 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00327_3300014.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1,098 - 24,059 nt. (total: 22,962 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 1097 - 24059:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg327_23

Search NORINE for peptide: strict or relaxed

AMP-binding (24..411): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DASTVAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00332_3300014.. - Region 1 - T3PKS

Download region GenBank file

Location: 1 - 23,429 nt. (total: 23,429 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00399_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 8,253 nt. (total: 8,253 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8253:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg399_1

Search NORINE for peptide: strict or relaxed

AMP-binding (11..280): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfFlLS---K
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 50% (weak)

ctg399_2

Search NORINE for peptide: strict or relaxed

AMP-binding (503..909): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00426_3300014.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,496 nt. (total: 5,496 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5496:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg426_1

Search NORINE for peptide: strict or relaxed

AMP-binding (522..921): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)