3300015158_5 - 46 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00010_3300015.. (original name was: 3300015158.a:Ga0167622_1000925)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS	1	12,567

c00011_3300015.. (original name was: 3300015158.a:Ga0167622_1000715)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	NRPS	1	14,798

c00021_3300015.. (original name was: 3300015158.a:Ga0167622_1003328)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS	1	5,392

c00023_3300015.. (original name was: 3300015158.a:Ga0167622_1001020)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS	1	11,829

c00050_3300015.. (original name was: 3300015158.a:Ga0167622_1000994)

Region	Type	From	To	Most similar known cluster		Similarity
Region 50.1	NRPS	1	12,058

c00058_3300015.. (original name was: 3300015158.a:Ga0167622_1002799)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	ladderane	1	6,120

c00071_3300015.. (original name was: 3300015158.a:Ga0167622_1002372)

Region	Type	From	To	Most similar known cluster		Similarity
Region 71.1	NRPS	1	6,951

c00101_3300015.. (original name was: 3300015158.a:Ga0167622_1001160)

Region	Type	From	To	Most similar known cluster		Similarity
Region 101.1	NRPS	1	10,962

c00110_3300015.. (original name was: 3300015158.a:Ga0167622_1005083)

Region	Type	From	To	Most similar known cluster		Similarity
Region 110.1	NRPS	1	3,955

c00124_3300015.. (original name was: 3300015158.a:Ga0167622_1002979)

Region	Type	From	To	Most similar known cluster		Similarity
Region 124.1	NRPS	1	5,811

c00131_3300015.. (original name was: 3300015158.a:Ga0167622_1002051)

Region	Type	From	To	Most similar known cluster		Similarity
Region 131.1	NRPS	1	7,622

c00149_3300015.. (original name was: 3300015158.a:Ga0167622_1002447)

Region	Type	From	To	Most similar known cluster		Similarity
Region 149.1	terpene	1	6,771

c00152_3300015.. (original name was: 3300015158.a:Ga0167622_1002263)

Region	Type	From	To	Most similar known cluster		Similarity
Region 152.1	NRPS	1	7,159

c00177_3300015.. (original name was: 3300015158.a:Ga0167622_1001404)

Region	Type	From	To	Most similar known cluster		Similarity
Region 177.1	NRPS	1	9,648

c00179_3300015.. (original name was: 3300015158.a:Ga0167622_1005807)

Region	Type	From	To	Most similar known cluster		Similarity
Region 179.1	NRPS	1	3,593

c00184_3300015.. (original name was: 3300015158.a:Ga0167622_1001623)

Region	Type	From	To	Most similar known cluster		Similarity
Region 184.1	NRPS	1	8,769

c00198_3300015.. (original name was: 3300015158.a:Ga0167622_1000291)

Region	Type	From	To	Most similar known cluster		Similarity
Region 198.1	lanthipeptide,bacteriocin	1	25,745

c00224_3300015.. (original name was: 3300015158.a:Ga0167622_1002356)

Region	Type	From	To	Most similar known cluster		Similarity
Region 224.1	NRPS	1	6,976

c00233_3300015.. (original name was: 3300015158.a:Ga0167622_1002833)

Region	Type	From	To	Most similar known cluster		Similarity
Region 233.1	NRPS	1	6,054

c00234_3300015.. (original name was: 3300015158.a:Ga0167622_1002639)

Region	Type	From	To	Most similar known cluster		Similarity
Region 234.1	NRPS	1	6,395

c00238_3300015.. (original name was: 3300015158.a:Ga0167622_1002798)

Region	Type	From	To	Most similar known cluster		Similarity
Region 238.1	NRPS	1	6,122

c00239_3300015.. (original name was: 3300015158.a:Ga0167622_1005252)

Region	Type	From	To	Most similar known cluster		Similarity
Region 239.1	lanthipeptide	1	3,860

c00253_3300015.. (original name was: 3300015158.a:Ga0167622_1004604)

Region	Type	From	To	Most similar known cluster		Similarity
Region 253.1	NRPS	1	4,252

c00259_3300015.. (original name was: 3300015158.a:Ga0167622_1005019)

Region	Type	From	To	Most similar known cluster		Similarity
Region 259.1	NRPS	1	3,994

c00266_3300015.. (original name was: 3300015158.a:Ga0167622_1000870)

Region	Type	From	To	Most similar known cluster		Similarity
Region 266.1	NRPS	1	13,033

c00271_3300015.. (original name was: 3300015158.a:Ga0167622_1005770)

Region	Type	From	To	Most similar known cluster		Similarity
Region 271.1	NRPS	1	3,613

c00290_3300015.. (original name was: 3300015158.a:Ga0167622_1001706)

Region	Type	From	To	Most similar known cluster		Similarity
Region 290.1	NRPS	1	8,519

c00299_3300015.. (original name was: 3300015158.a:Ga0167622_1004686)

Region	Type	From	To	Most similar known cluster		Similarity
Region 299.1	NRPS	1	4,197

c00301_3300015.. (original name was: 3300015158.a:Ga0167622_1003459)

Region	Type	From	To	Most similar known cluster		Similarity
Region 301.1	NRPS	1	5,224

c00312_3300015.. (original name was: 3300015158.a:Ga0167622_1001413)

Region	Type	From	To	Most similar known cluster		Similarity
Region 312.1	NRPS	1	9,584

c00318_3300015.. (original name was: 3300015158.a:Ga0167622_1007304)

Region	Type	From	To	Most similar known cluster		Similarity
Region 318.1	NRPS	1	3,018

c00331_3300015.. (original name was: 3300015158.a:Ga0167622_1003391)

Region	Type	From	To	Most similar known cluster		Similarity
Region 331.1	NRPS,T1PKS	1	5,312

c00334_3300015.. (original name was: 3300015158.a:Ga0167622_1002073)

Region	Type	From	To	Most similar known cluster		Similarity
Region 334.1	NRPS	1	7,578

c00342_3300015.. (original name was: 3300015158.a:Ga0167622_1006274)

Region	Type	From	To	Most similar known cluster		Similarity
Region 342.1	NRPS-like	1	3,389

c00350_3300015.. (original name was: 3300015158.a:Ga0167622_1004407)

Region	Type	From	To	Most similar known cluster		Similarity
Region 350.1	NRPS	1	4,400

c00367_3300015.. (original name was: 3300015158.a:Ga0167622_1000544)

Region	Type	From	To	Most similar known cluster		Similarity
Region 367.1	bacteriocin	6,589	17,426

c00385_3300015.. (original name was: 3300015158.a:Ga0167622_1004289)

Region	Type	From	To	Most similar known cluster		Similarity
Region 385.1	bacteriocin	1	4,472

c00390_3300015.. (original name was: 3300015158.a:Ga0167622_1000629)

Region	Type	From	To	Most similar known cluster		Similarity
Region 390.1	NRPS	1	15,930

c00400_3300015.. (original name was: 3300015158.a:Ga0167622_1004739)

Region	Type	From	To	Most similar known cluster		Similarity
Region 400.1	NRPS	1	4,165

c00440_3300015.. (original name was: 3300015158.a:Ga0167622_1000127)

Region	Type	From	To	Most similar known cluster		Similarity
Region 440.1	NRPS	1	45,622

c00453_3300015.. (original name was: 3300015158.a:Ga0167622_1003743)

Region	Type	From	To	Most similar known cluster		Similarity
Region 453.1	NRPS	1	4,937

c00477_3300015.. (original name was: 3300015158.a:Ga0167622_1000814)

Region	Type	From	To	Most similar known cluster		Similarity
Region 477.1	lanthipeptide	1	13,661

c00483_3300015.. (original name was: 3300015158.a:Ga0167622_1005945)

Region	Type	From	To	Most similar known cluster		Similarity
Region 483.1	NRPS	1	3,534

c00508_3300015.. (original name was: 3300015158.a:Ga0167622_1000586)

Region	Type	From	To	Most similar known cluster		Similarity
Region 508.1	T3PKS	1	16,625

c00516_3300015.. (original name was: 3300015158.a:Ga0167622_1001185)

Region	Type	From	To	Most similar known cluster		Similarity
Region 516.1	NRPS	1	10,847

c00517_3300015.. (original name was: 3300015158.a:Ga0167622_1000362)

Region	Type	From	To	Most similar known cluster		Similarity
Region 517.1	NRPS	1	22,587

Region	Type	From	To	Similarity
Region 10.1	NRPS	1	12,567
Region 11.1	NRPS	1	14,798
Region 21.1	NRPS	1	5,392
Region 23.1	NRPS	1	11,829
Region 50.1	NRPS	1	12,058
Region 58.1	ladderane	1	6,120
Region 71.1	NRPS	1	6,951
Region 101.1	NRPS	1	10,962
Region 110.1	NRPS	1	3,955
Region 124.1	NRPS	1	5,811
Region 131.1	NRPS	1	7,622
Region 149.1	terpene	1	6,771
Region 152.1	NRPS	1	7,159
Region 177.1	NRPS	1	9,648
Region 179.1	NRPS	1	3,593
Region 184.1	NRPS	1	8,769
Region 198.1	lanthipeptide,bacteriocin	1	25,745
Region 224.1	NRPS	1	6,976
Region 233.1	NRPS	1	6,054
Region 234.1	NRPS	1	6,395
Region 238.1	NRPS	1	6,122
Region 239.1	lanthipeptide	1	3,860
Region 253.1	NRPS	1	4,252
Region 259.1	NRPS	1	3,994
Region 266.1	NRPS	1	13,033
Region 271.1	NRPS	1	3,613
Region 290.1	NRPS	1	8,519
Region 299.1	NRPS	1	4,197
Region 301.1	NRPS	1	5,224
Region 312.1	NRPS	1	9,584
Region 318.1	NRPS	1	3,018
Region 331.1	NRPS,T1PKS	1	5,312
Region 334.1	NRPS	1	7,578
Region 342.1	NRPS-like	1	3,389
Region 350.1	NRPS	1	4,400
Region 367.1	bacteriocin	6,589	17,426
Region 385.1	bacteriocin	1	4,472
Region 390.1	NRPS	1	15,930
Region 400.1	NRPS	1	4,165
Region 440.1	NRPS	1	45,622
Region 453.1	NRPS	1	4,937
Region 477.1	lanthipeptide	1	13,661
Region 483.1	NRPS	1	3,534
Region 508.1	T3PKS	1	16,625
Region 516.1	NRPS	1	10,847
Region 517.1	NRPS	1	22,587

No secondary metabolite regions were found in these records:: c00001_3300015.. (original name was: 3300015158.a:Ga0167622_1007351); c00002_3300015.. (original name was: 3300015158.a:Ga0167622_1005159); c00003_3300015.. (original name was: 3300015158.a:Ga0167622_1004414); c00004_3300015.. (original name was: 3300015158.a:Ga0167622_1003806); c00005_3300015.. (original name was: 3300015158.a:Ga0167622_1003311); c00006_3300015.. (original name was: 3300015158.a:Ga0167622_1002072); c00007_3300015.. (original name was: 3300015158.a:Ga0167622_1001985); c00008_3300015.. (original name was: 3300015158.a:Ga0167622_1001495); c00009_3300015.. (original name was: 3300015158.a:Ga0167622_1001129); c00012_3300015.. (original name was: 3300015158.a:Ga0167622_1000455); c00013_3300015.. (original name was: 3300015158.a:Ga0167622_1000516); c00014_3300015.. (original name was: 3300015158.a:Ga0167622_1005669); c00015_3300015.. (original name was: 3300015158.a:Ga0167622_1001647); c00016_3300015.. (original name was: 3300015158.a:Ga0167622_1000788); c00017_3300015.. (original name was: 3300015158.a:Ga0167622_1006765); c00018_3300015.. (original name was: 3300015158.a:Ga0167622_1003812); c00019_3300015.. (original name was: 3300015158.a:Ga0167622_1003792); c00020_3300015.. (original name was: 3300015158.a:Ga0167622_1003380); c00022_3300015.. (original name was: 3300015158.a:Ga0167622_1002078); c00024_3300015.. (original name was: 3300015158.a:Ga0167622_1005113); c00025_3300015.. (original name was: 3300015158.a:Ga0167622_1007268); c00026_3300015.. (original name was: 3300015158.a:Ga0167622_1000684); c00027_3300015.. (original name was: 3300015158.a:Ga0167622_1002330); c00028_3300015.. (original name was: 3300015158.a:Ga0167622_1003976); c00029_3300015.. (original name was: 3300015158.a:Ga0167622_1006442); c00030_3300015.. (original name was: 3300015158.a:Ga0167622_1004234); c00031_3300015.. (original name was: 3300015158.a:Ga0167622_1003007); c00032_3300015.. (original name was: 3300015158.a:Ga0167622_1006103); c00033_3300015.. (original name was: 3300015158.a:Ga0167622_1006926); c00034_3300015.. (original name was: 3300015158.a:Ga0167622_1007108); c00035_3300015.. (original name was: 3300015158.a:Ga0167622_1000906); c00036_3300015.. (original name was: 3300015158.a:Ga0167622_1001481); c00037_3300015.. (original name was: 3300015158.a:Ga0167622_1002304); c00038_3300015.. (original name was: 3300015158.a:Ga0167622_1003950); c00039_3300015.. (original name was: 3300015158.a:Ga0167622_1001879); c00040_3300015.. (original name was: 3300015158.a:Ga0167622_1001191); c00041_3300015.. (original name was: 3300015158.a:Ga0167622_1002385); c00042_3300015.. (original name was: 3300015158.a:Ga0167622_1001193); c00043_3300015.. (original name was: 3300015158.a:Ga0167622_1001230); c00044_3300015.. (original name was: 3300015158.a:Ga0167622_1001127); c00045_3300015.. (original name was: 3300015158.a:Ga0167622_1000530); c00046_3300015.. (original name was: 3300015158.a:Ga0167622_1003716); c00047_3300015.. (original name was: 3300015158.a:Ga0167622_1004940); c00048_3300015.. (original name was: 3300015158.a:Ga0167622_1000825); c00049_3300015.. (original name was: 3300015158.a:Ga0167622_1005932); c00051_3300015.. (original name was: 3300015158.a:Ga0167622_1001024); c00052_3300015.. (original name was: 3300015158.a:Ga0167622_1002670); c00053_3300015.. (original name was: 3300015158.a:Ga0167622_1001001); c00054_3300015.. (original name was: 3300015158.a:Ga0167622_1000846); c00055_3300015.. (original name was: 3300015158.a:Ga0167622_1001045); c00056_3300015.. (original name was: 3300015158.a:Ga0167622_1003514); c00057_3300015.. (original name was: 3300015158.a:Ga0167622_1001207); c00059_3300015.. (original name was: 3300015158.a:Ga0167622_1000819); c00060_3300015.. (original name was: 3300015158.a:Ga0167622_1004934); c00061_3300015.. (original name was: 3300015158.a:Ga0167622_1000618); c00062_3300015.. (original name was: 3300015158.a:Ga0167622_1003910); c00063_3300015.. (original name was: 3300015158.a:Ga0167622_1000919); c00064_3300015.. (original name was: 3300015158.a:Ga0167622_1000930); c00065_3300015.. (original name was: 3300015158.a:Ga0167622_1003399); c00066_3300015.. (original name was: 3300015158.a:Ga0167622_1000521); c00067_3300015.. (original name was: 3300015158.a:Ga0167622_1003813); c00068_3300015.. (original name was: 3300015158.a:Ga0167622_1001344); c00069_3300015.. (original name was: 3300015158.a:Ga0167622_1000827); c00070_3300015.. (original name was: 3300015158.a:Ga0167622_1000726); c00072_3300015.. (original name was: 3300015158.a:Ga0167622_1005645); c00073_3300015.. (original name was: 3300015158.a:Ga0167622_1003176); c00074_3300015.. (original name was: 3300015158.a:Ga0167622_1000328); c00075_3300015.. (original name was: 3300015158.a:Ga0167622_1003114); c00076_3300015.. (original name was: 3300015158.a:Ga0167622_1001437); c00077_3300015.. (original name was: 3300015158.a:Ga0167622_1000952); c00078_3300015.. (original name was: 3300015158.a:Ga0167622_1000841); c00079_3300015.. (original name was: 3300015158.a:Ga0167622_1002487); c00080_3300015.. (original name was: 3300015158.a:Ga0167622_1005779); c00081_3300015.. (original name was: 3300015158.a:Ga0167622_1003826); c00082_3300015.. (original name was: 3300015158.a:Ga0167622_1001015); c00083_3300015.. (original name was: 3300015158.a:Ga0167622_1000816); c00084_3300015.. (original name was: 3300015158.a:Ga0167622_1000831); c00085_3300015.. (original name was: 3300015158.a:Ga0167622_1004123); c00086_3300015.. (original name was: 3300015158.a:Ga0167622_1000741); c00087_3300015.. (original name was: 3300015158.a:Ga0167622_1000547); c00088_3300015.. (original name was: 3300015158.a:Ga0167622_1002193); c00089_3300015.. (original name was: 3300015158.a:Ga0167622_1000746); c00090_3300015.. (original name was: 3300015158.a:Ga0167622_1004195); c00091_3300015.. (original name was: 3300015158.a:Ga0167622_1002549); c00092_3300015.. (original name was: 3300015158.a:Ga0167622_1001741); c00093_3300015.. (original name was: 3300015158.a:Ga0167622_1002139); c00094_3300015.. (original name was: 3300015158.a:Ga0167622_1002962); c00095_3300015.. (original name was: 3300015158.a:Ga0167622_1005404); c00096_3300015.. (original name was: 3300015158.a:Ga0167622_1002935); c00097_3300015.. (original name was: 3300015158.a:Ga0167622_1006307); c00098_3300015.. (original name was: 3300015158.a:Ga0167622_1000933); c00099_3300015.. (original name was: 3300015158.a:Ga0167622_1005877); c00100_3300015.. (original name was: 3300015158.a:Ga0167622_1002796); c00102_3300015.. (original name was: 3300015158.a:Ga0167622_1005806); c00103_3300015.. (original name was: 3300015158.a:Ga0167622_1007292); c00104_3300015.. (original name was: 3300015158.a:Ga0167622_1000748); c00105_3300015.. (original name was: 3300015158.a:Ga0167622_1002081); c00106_3300015.. (original name was: 3300015158.a:Ga0167622_1002904); c00107_3300015.. (original name was: 3300015158.a:Ga0167622_1002495); c00108_3300015.. (original name was: 3300015158.a:Ga0167622_1002695); c00109_3300015.. (original name was: 3300015158.a:Ga0167622_1000650); c00111_3300015.. (original name was: 3300015158.a:Ga0167622_1005614); c00112_3300015.. (original name was: 3300015158.a:Ga0167622_1002828); c00113_3300015.. (original name was: 3300015158.a:Ga0167622_1001566); c00114_3300015.. (original name was: 3300015158.a:Ga0167622_1007327); c00115_3300015.. (original name was: 3300015158.a:Ga0167622_1003481); c00116_3300015.. (original name was: 3300015158.a:Ga0167622_1005117); c00117_3300015.. (original name was: 3300015158.a:Ga0167622_1003409); c00118_3300015.. (original name was: 3300015158.a:Ga0167622_1005996); c00119_3300015.. (original name was: 3300015158.a:Ga0167622_1001088); c00120_3300015.. (original name was: 3300015158.a:Ga0167622_1005461); c00121_3300015.. (original name was: 3300015158.a:Ga0167622_1005721); c00122_3300015.. (original name was: 3300015158.a:Ga0167622_1004914); c00123_3300015.. (original name was: 3300015158.a:Ga0167622_1000934); c00125_3300015.. (original name was: 3300015158.a:Ga0167622_1002172); c00126_3300015.. (original name was: 3300015158.a:Ga0167622_1005035); c00127_3300015.. (original name was: 3300015158.a:Ga0167622_1005254); c00128_3300015.. (original name was: 3300015158.a:Ga0167622_1001573); c00129_3300015.. (original name was: 3300015158.a:Ga0167622_1000755); c00130_3300015.. (original name was: 3300015158.a:Ga0167622_1004014); c00132_3300015.. (original name was: 3300015158.a:Ga0167622_1001228); c00133_3300015.. (original name was: 3300015158.a:Ga0167622_1000830); c00134_3300015.. (original name was: 3300015158.a:Ga0167622_1003284); c00135_3300015.. (original name was: 3300015158.a:Ga0167622_1004264); c00136_3300015.. (original name was: 3300015158.a:Ga0167622_1001810); c00137_3300015.. (original name was: 3300015158.a:Ga0167622_1001381); c00138_3300015.. (original name was: 3300015158.a:Ga0167622_1003835); c00139_3300015.. (original name was: 3300015158.a:Ga0167622_1002415); c00140_3300015.. (original name was: 3300015158.a:Ga0167622_1003238); c00141_3300015.. (original name was: 3300015158.a:Ga0167622_1001497); c00142_3300015.. (original name was: 3300015158.a:Ga0167622_1003966); c00143_3300015.. (original name was: 3300015158.a:Ga0167622_1002335); c00144_3300015.. (original name was: 3300015158.a:Ga0167622_1001512); c00145_3300015.. (original name was: 3300015158.a:Ga0167622_1000821); c00146_3300015.. (original name was: 3300015158.a:Ga0167622_1001066); c00147_3300015.. (original name was: 3300015158.a:Ga0167622_1004393); c00148_3300015.. (original name was: 3300015158.a:Ga0167622_1000811); c00150_3300015.. (original name was: 3300015158.a:Ga0167622_1003674); c00151_3300015.. (original name was: 3300015158.a:Ga0167622_1001036); c00153_3300015.. (original name was: 3300015158.a:Ga0167622_1003431); c00154_3300015.. (original name was: 3300015158.a:Ga0167622_1003022); c00155_3300015.. (original name was: 3300015158.a:Ga0167622_1000977); c00156_3300015.. (original name was: 3300015158.a:Ga0167622_1000446); c00157_3300015.. (original name was: 3300015158.a:Ga0167622_1001910); c00158_3300015.. (original name was: 3300015158.a:Ga0167622_1000995); c00159_3300015.. (original name was: 3300015158.a:Ga0167622_1003464); c00160_3300015.. (original name was: 3300015158.a:Ga0167622_1001828); c00161_3300015.. (original name was: 3300015158.a:Ga0167622_1006002); c00162_3300015.. (original name was: 3300015158.a:Ga0167622_1001912); c00163_3300015.. (original name was: 3300015158.a:Ga0167622_1002730); c00164_3300015.. (original name was: 3300015158.a:Ga0167622_1001149); c00165_3300015.. (original name was: 3300015158.a:Ga0167622_1006798); c00166_3300015.. (original name was: 3300015158.a:Ga0167622_1001582); c00167_3300015.. (original name was: 3300015158.a:Ga0167622_1001861); c00168_3300015.. (original name was: 3300015158.a:Ga0167622_1006360); c00169_3300015.. (original name was: 3300015158.a:Ga0167622_1003579); c00170_3300015.. (original name was: 3300015158.a:Ga0167622_1001534); c00171_3300015.. (original name was: 3300015158.a:Ga0167622_1000340); c00172_3300015.. (original name was: 3300015158.a:Ga0167622_1000738); c00173_3300015.. (original name was: 3300015158.a:Ga0167622_1000309); c00174_3300015.. (original name was: 3300015158.a:Ga0167622_1000274); c00175_3300015.. (original name was: 3300015158.a:Ga0167622_1006035); c00176_3300015.. (original name was: 3300015158.a:Ga0167622_1001006); c00178_3300015.. (original name was: 3300015158.a:Ga0167622_1000635); c00180_3300015.. (original name was: 3300015158.a:Ga0167622_1000490); c00181_3300015.. (original name was: 3300015158.a:Ga0167622_1006063); c00182_3300015.. (original name was: 3300015158.a:Ga0167622_1003360); c00183_3300015.. (original name was: 3300015158.a:Ga0167622_1005006); c00185_3300015.. (original name was: 3300015158.a:Ga0167622_1005723); c00186_3300015.. (original name was: 3300015158.a:Ga0167622_1004077); c00187_3300015.. (original name was: 3300015158.a:Ga0167622_1005600); c00188_3300015.. (original name was: 3300015158.a:Ga0167622_1000255); c00189_3300015.. (original name was: 3300015158.a:Ga0167622_1005572); c00190_3300015.. (original name was: 3300015158.a:Ga0167622_1000454); c00191_3300015.. (original name was: 3300015158.a:Ga0167622_1007355); c00192_3300015.. (original name was: 3300015158.a:Ga0167622_1003240); c00193_3300015.. (original name was: 3300015158.a:Ga0167622_1002082); c00194_3300015.. (original name was: 3300015158.a:Ga0167622_1005374); c00195_3300015.. (original name was: 3300015158.a:Ga0167622_1002464); c00196_3300015.. (original name was: 3300015158.a:Ga0167622_1004933); c00197_3300015.. (original name was: 3300015158.a:Ga0167622_1006426); c00199_3300015.. (original name was: 3300015158.a:Ga0167622_1004834); c00200_3300015.. (original name was: 3300015158.a:Ga0167622_1003683); c00201_3300015.. (original name was: 3300015158.a:Ga0167622_1002441); c00202_3300015.. (original name was: 3300015158.a:Ga0167622_1004910); c00203_3300015.. (original name was: 3300015158.a:Ga0167622_1001417); c00204_3300015.. (original name was: 3300015158.a:Ga0167622_1002235); c00205_3300015.. (original name was: 3300015158.a:Ga0167622_1005550); c00206_3300015.. (original name was: 3300015158.a:Ga0167622_1000415); c00207_3300015.. (original name was: 3300015158.a:Ga0167622_1003707); c00208_3300015.. (original name was: 3300015158.a:Ga0167622_1001652); c00209_3300015.. (original name was: 3300015158.a:Ga0167622_1005333); c00210_3300015.. (original name was: 3300015158.a:Ga0167622_1006229); c00211_3300015.. (original name was: 3300015158.a:Ga0167622_1005002); c00212_3300015.. (original name was: 3300015158.a:Ga0167622_1003157); c00213_3300015.. (original name was: 3300015158.a:Ga0167622_1002339); c00214_3300015.. (original name was: 3300015158.a:Ga0167622_1005430); c00215_3300015.. (original name was: 3300015158.a:Ga0167622_1000334); c00216_3300015.. (original name was: 3300015158.a:Ga0167622_1002523); c00217_3300015.. (original name was: 3300015158.a:Ga0167622_1001410); c00218_3300015.. (original name was: 3300015158.a:Ga0167622_1004682); c00219_3300015.. (original name was: 3300015158.a:Ga0167622_1006440); c00220_3300015.. (original name was: 3300015158.a:Ga0167622_1003986); c00221_3300015.. (original name was: 3300015158.a:Ga0167622_1000714); c00222_3300015.. (original name was: 3300015158.a:Ga0167622_1002062); c00223_3300015.. (original name was: 3300015158.a:Ga0167622_1003875); c00225_3300015.. (original name was: 3300015158.a:Ga0167622_1004798); c00226_3300015.. (original name was: 3300015158.a:Ga0167622_1000683); c00227_3300015.. (original name was: 3300015158.a:Ga0167622_1003152); c00228_3300015.. (original name was: 3300015158.a:Ga0167622_1003948); c00229_3300015.. (original name was: 3300015158.a:Ga0167622_1007156); c00230_3300015.. (original name was: 3300015158.a:Ga0167622_1005545); c00231_3300015.. (original name was: 3300015158.a:Ga0167622_1001430); c00232_3300015.. (original name was: 3300015158.a:Ga0167622_1004723); c00235_3300015.. (original name was: 3300015158.a:Ga0167622_1002238); c00236_3300015.. (original name was: 3300015158.a:Ga0167622_1003061); c00237_3300015.. (original name was: 3300015158.a:Ga0167622_1007176); c00240_3300015.. (original name was: 3300015158.a:Ga0167622_1004447); c00241_3300015.. (original name was: 3300015158.a:Ga0167622_1004343); c00242_3300015.. (original name was: 3300015158.a:Ga0167622_1004408); c00243_3300015.. (original name was: 3300015158.a:Ga0167622_1000605); c00244_3300015.. (original name was: 3300015158.a:Ga0167622_1001832); c00245_3300015.. (original name was: 3300015158.a:Ga0167622_1002573); c00246_3300015.. (original name was: 3300015158.a:Ga0167622_1003967); c00247_3300015.. (original name was: 3300015158.a:Ga0167622_1005194); c00248_3300015.. (original name was: 3300015158.a:Ga0167622_1004276); c00249_3300015.. (original name was: 3300015158.a:Ga0167622_1005875); c00250_3300015.. (original name was: 3300015158.a:Ga0167622_1000548); c00251_3300015.. (original name was: 3300015158.a:Ga0167622_1002194); c00252_3300015.. (original name was: 3300015158.a:Ga0167622_1002017); c00254_3300015.. (original name was: 3300015158.a:Ga0167622_1002867); c00255_3300015.. (original name was: 3300015158.a:Ga0167622_1001221); c00256_3300015.. (original name was: 3300015158.a:Ga0167622_1000812); c00257_3300015.. (original name was: 3300015158.a:Ga0167622_1003002); c00258_3300015.. (original name was: 3300015158.a:Ga0167622_1001356); c00260_3300015.. (original name was: 3300015158.a:Ga0167622_1002550); c00261_3300015.. (original name was: 3300015158.a:Ga0167622_1004595); c00262_3300015.. (original name was: 3300015158.a:Ga0167622_1004596); c00263_3300015.. (original name was: 3300015158.a:Ga0167622_1001257); c00264_3300015.. (original name was: 3300015158.a:Ga0167622_1006222); c00265_3300015.. (original name was: 3300015158.a:Ga0167622_1000461); c00267_3300015.. (original name was: 3300015158.a:Ga0167622_1004321); c00268_3300015.. (original name was: 3300015158.a:Ga0167622_1002286); c00269_3300015.. (original name was: 3300015158.a:Ga0167622_1000640); c00270_3300015.. (original name was: 3300015158.a:Ga0167622_1005714); c00272_3300015.. (original name was: 3300015158.a:Ga0167622_1007271); c00273_3300015.. (original name was: 3300015158.a:Ga0167622_1003979); c00274_3300015.. (original name was: 3300015158.a:Ga0167622_1003161); c00275_3300015.. (original name was: 3300015158.a:Ga0167622_1000298); c00276_3300015.. (original name was: 3300015158.a:Ga0167622_1006942); c00277_3300015.. (original name was: 3300015158.a:Ga0167622_1003650); c00278_3300015.. (original name was: 3300015158.a:Ga0167622_1003582); c00279_3300015.. (original name was: 3300015158.a:Ga0167622_1003370); c00280_3300015.. (original name was: 3300015158.a:Ga0167622_1004193); c00281_3300015.. (original name was: 3300015158.a:Ga0167622_1004475); c00282_3300015.. (original name was: 3300015158.a:Ga0167622_1002539); c00283_3300015.. (original name was: 3300015158.a:Ga0167622_1005043); c00284_3300015.. (original name was: 3300015158.a:Ga0167622_1000928); c00285_3300015.. (original name was: 3300015158.a:Ga0167622_1000519); c00286_3300015.. (original name was: 3300015158.a:Ga0167622_1001908); c00287_3300015.. (original name was: 3300015158.a:Ga0167622_1007215); c00288_3300015.. (original name was: 3300015158.a:Ga0167622_1002810); c00289_3300015.. (original name was: 3300015158.a:Ga0167622_1003633); c00291_3300015.. (original name was: 3300015158.a:Ga0167622_1002178); c00292_3300015.. (original name was: 3300015158.a:Ga0167622_1007049); c00293_3300015.. (original name was: 3300015158.a:Ga0167622_1002934); c00294_3300015.. (original name was: 3300015158.a:Ga0167622_1005822); c00295_3300015.. (original name was: 3300015158.a:Ga0167622_1001707); c00296_3300015.. (original name was: 3300015158.a:Ga0167622_1006604); c00297_3300015.. (original name was: 3300015158.a:Ga0167622_1005355); c00298_3300015.. (original name was: 3300015158.a:Ga0167622_1004562); c00300_3300015.. (original name was: 3300015158.a:Ga0167622_1000990); c00302_3300015.. (original name was: 3300015158.a:Ga0167622_1001797); c00303_3300015.. (original name was: 3300015158.a:Ga0167622_1001519); c00304_3300015.. (original name was: 3300015158.a:Ga0167622_1003342); c00305_3300015.. (original name was: 3300015158.a:Ga0167622_1000873); c00306_3300015.. (original name was: 3300015158.a:Ga0167622_1002933); c00307_3300015.. (original name was: 3300015158.a:Ga0167622_1000464); c00308_3300015.. (original name was: 3300015158.a:Ga0167622_1003316); c00309_3300015.. (original name was: 3300015158.a:Ga0167622_1004139); c00310_3300015.. (original name was: 3300015158.a:Ga0167622_1001552); c00311_3300015.. (original name was: 3300015158.a:Ga0167622_1002779); c00313_3300015.. (original name was: 3300015158.a:Ga0167622_1000590); c00314_3300015.. (original name was: 3300015158.a:Ga0167622_1006760); c00315_3300015.. (original name was: 3300015158.a:Ga0167622_1000999); c00316_3300015.. (original name was: 3300015158.a:Ga0167622_1005907); c00317_3300015.. (original name was: 3300015158.a:Ga0167622_1004012); c00319_3300015.. (original name was: 3300015158.a:Ga0167622_1000936); c00320_3300015.. (original name was: 3300015158.a:Ga0167622_1002981); c00321_3300015.. (original name was: 3300015158.a:Ga0167622_1000701); c00322_3300015.. (original name was: 3300015158.a:Ga0167622_1007285); c00323_3300015.. (original name was: 3300015158.a:Ga0167622_1002543); c00324_3300015.. (original name was: 3300015158.a:Ga0167622_1002941); c00325_3300015.. (original name was: 3300015158.a:Ga0167622_1006622); c00326_3300015.. (original name was: 3300015158.a:Ga0167622_1005047); c00327_3300015.. (original name was: 3300015158.a:Ga0167622_1000932); c00328_3300015.. (original name was: 3300015158.a:Ga0167622_1001148); c00329_3300015.. (original name was: 3300015158.a:Ga0167622_1001123); c00330_3300015.. (original name was: 3300015158.a:Ga0167622_1005238); c00332_3300015.. (original name was: 3300015158.a:Ga0167622_1001745); c00333_3300015.. (original name was: 3300015158.a:Ga0167622_1003600); c00335_3300015.. (original name was: 3300015158.a:Ga0167622_1000620); c00336_3300015.. (original name was: 3300015158.a:Ga0167622_1007143); c00337_3300015.. (original name was: 3300015158.a:Ga0167622_1002205); c00338_3300015.. (original name was: 3300015158.a:Ga0167622_1002802); c00339_3300015.. (original name was: 3300015158.a:Ga0167622_1000757); c00340_3300015.. (original name was: 3300015158.a:Ga0167622_1004655); c00341_3300015.. (original name was: 3300015158.a:Ga0167622_1000565); c00343_3300015.. (original name was: 3300015158.a:Ga0167622_1005451); c00344_3300015.. (original name was: 3300015158.a:Ga0167622_1006473); c00345_3300015.. (original name was: 3300015158.a:Ga0167622_1005487); c00346_3300015.. (original name was: 3300015158.a:Ga0167622_1007099); c00347_3300015.. (original name was: 3300015158.a:Ga0167622_1001373); c00348_3300015.. (original name was: 3300015158.a:Ga0167622_1001186); c00349_3300015.. (original name was: 3300015158.a:Ga0167622_1005375); c00351_3300015.. (original name was: 3300015158.a:Ga0167622_1006043); c00352_3300015.. (original name was: 3300015158.a:Ga0167622_1003136); c00353_3300015.. (original name was: 3300015158.a:Ga0167622_1003540); c00354_3300015.. (original name was: 3300015158.a:Ga0167622_1000248); c00355_3300015.. (original name was: 3300015158.a:Ga0167622_1004363); c00356_3300015.. (original name was: 3300015158.a:Ga0167622_1005557); c00357_3300015.. (original name was: 3300015158.a:Ga0167622_1005232); c00358_3300015.. (original name was: 3300015158.a:Ga0167622_1001142); c00359_3300015.. (original name was: 3300015158.a:Ga0167622_1006903); c00360_3300015.. (original name was: 3300015158.a:Ga0167622_1001995); c00361_3300015.. (original name was: 3300015158.a:Ga0167622_1002610); c00362_3300015.. (original name was: 3300015158.a:Ga0167622_1005079); c00363_3300015.. (original name was: 3300015158.a:Ga0167622_1003849); c00364_3300015.. (original name was: 3300015158.a:Ga0167622_1000958); c00365_3300015.. (original name was: 3300015158.a:Ga0167622_1004230); c00366_3300015.. (original name was: 3300015158.a:Ga0167622_1003407); c00368_3300015.. (original name was: 3300015158.a:Ga0167622_1000724); c00369_3300015.. (original name was: 3300015158.a:Ga0167622_1003193); c00370_3300015.. (original name was: 3300015158.a:Ga0167622_1001547); c00371_3300015.. (original name was: 3300015158.a:Ga0167622_1002696); c00372_3300015.. (original name was: 3300015158.a:Ga0167622_1000242); c00373_3300015.. (original name was: 3300015158.a:Ga0167622_1000380); c00374_3300015.. (original name was: 3300015158.a:Ga0167622_1001736); c00375_3300015.. (original name was: 3300015158.a:Ga0167622_1002150); c00376_3300015.. (original name was: 3300015158.a:Ga0167622_1002973); c00377_3300015.. (original name was: 3300015158.a:Ga0167622_1001327); c00378_3300015.. (original name was: 3300015158.a:Ga0167622_1000504); c00379_3300015.. (original name was: 3300015158.a:Ga0167622_1001620); c00380_3300015.. (original name was: 3300015158.a:Ga0167622_1002451); c00381_3300015.. (original name was: 3300015158.a:Ga0167622_1002185); c00382_3300015.. (original name was: 3300015158.a:Ga0167622_1000539); c00383_3300015.. (original name was: 3300015158.a:Ga0167622_1002244); c00384_3300015.. (original name was: 3300015158.a:Ga0167622_1005112); c00386_3300015.. (original name was: 3300015158.a:Ga0167622_1002643); c00387_3300015.. (original name was: 3300015158.a:Ga0167622_1003461); c00388_3300015.. (original name was: 3300015158.a:Ga0167622_1004904); c00389_3300015.. (original name was: 3300015158.a:Ga0167622_1002435); c00391_3300015.. (original name was: 3300015158.a:Ga0167622_1002275); c00392_3300015.. (original name was: 3300015158.a:Ga0167622_1006809); c00393_3300015.. (original name was: 3300015158.a:Ga0167622_1001048); c00394_3300015.. (original name was: 3300015158.a:Ga0167622_1003517); c00395_3300015.. (original name was: 3300015158.a:Ga0167622_1001558); c00396_3300015.. (original name was: 3300015158.a:Ga0167622_1002381); c00397_3300015.. (original name was: 3300015158.a:Ga0167622_1004305); c00398_3300015.. (original name was: 3300015158.a:Ga0167622_1003502); c00399_3300015.. (original name was: 3300015158.a:Ga0167622_1001033); c00401_3300015.. (original name was: 3300015158.a:Ga0167622_1000624); c00402_3300015.. (original name was: 3300015158.a:Ga0167622_1001523); c00403_3300015.. (original name was: 3300015158.a:Ga0167622_1002084); c00404_3300015.. (original name was: 3300015158.a:Ga0167622_1002283); c00405_3300015.. (original name was: 3300015158.a:Ga0167622_1001086); c00406_3300015.. (original name was: 3300015158.a:Ga0167622_1000657); c00407_3300015.. (original name was: 3300015158.a:Ga0167622_1003949); c00408_3300015.. (original name was: 3300015158.a:Ga0167622_1003080); c00409_3300015.. (original name was: 3300015158.a:Ga0167622_1004979); c00410_3300015.. (original name was: 3300015158.a:Ga0167622_1001687); c00411_3300015.. (original name was: 3300015158.a:Ga0167622_1002087); c00412_3300015.. (original name was: 3300015158.a:Ga0167622_1002882); c00413_3300015.. (original name was: 3300015158.a:Ga0167622_1001603); c00414_3300015.. (original name was: 3300015158.a:Ga0167622_1004748); c00415_3300015.. (original name was: 3300015158.a:Ga0167622_1002279); c00416_3300015.. (original name was: 3300015158.a:Ga0167622_1006394); c00417_3300015.. (original name was: 3300015158.a:Ga0167622_1000486); c00418_3300015.. (original name was: 3300015158.a:Ga0167622_1002955); c00419_3300015.. (original name was: 3300015158.a:Ga0167622_1001309); c00420_3300015.. (original name was: 3300015158.a:Ga0167622_1001676); c00421_3300015.. (original name was: 3300015158.a:Ga0167622_1006702); c00422_3300015.. (original name was: 3300015158.a:Ga0167622_1004233); c00423_3300015.. (original name was: 3300015158.a:Ga0167622_1001764); c00424_3300015.. (original name was: 3300015158.a:Ga0167622_1001777); c00425_3300015.. (original name was: 3300015158.a:Ga0167622_1001379); c00426_3300015.. (original name was: 3300015158.a:Ga0167622_1000561); c00427_3300015.. (original name was: 3300015158.a:Ga0167622_1000960); c00428_3300015.. (original name was: 3300015158.a:Ga0167622_1001949); c00429_3300015.. (original name was: 3300015158.a:Ga0167622_1000584); c00430_3300015.. (original name was: 3300015158.a:Ga0167622_1005522); c00431_3300015.. (original name was: 3300015158.a:Ga0167622_1002086); c00432_3300015.. (original name was: 3300015158.a:Ga0167622_1001263); c00433_3300015.. (original name was: 3300015158.a:Ga0167622_1002220); c00434_3300015.. (original name was: 3300015158.a:Ga0167622_1000574); c00435_3300015.. (original name was: 3300015158.a:Ga0167622_1000778); c00436_3300015.. (original name was: 3300015158.a:Ga0167622_1002069); c00437_3300015.. (original name was: 3300015158.a:Ga0167622_1002123); c00438_3300015.. (original name was: 3300015158.a:Ga0167622_1000477); c00439_3300015.. (original name was: 3300015158.a:Ga0167622_1000673); c00441_3300015.. (original name was: 3300015158.a:Ga0167622_1000950); c00442_3300015.. (original name was: 3300015158.a:Ga0167622_1000622); c00443_3300015.. (original name was: 3300015158.a:Ga0167622_1003894); c00444_3300015.. (original name was: 3300015158.a:Ga0167622_1002838); c00445_3300015.. (original name was: 3300015158.a:Ga0167622_1000649); c00446_3300015.. (original name was: 3300015158.a:Ga0167622_1003941); c00447_3300015.. (original name was: 3300015158.a:Ga0167622_1000236); c00448_3300015.. (original name was: 3300015158.a:Ga0167622_1001054); c00449_3300015.. (original name was: 3300015158.a:Ga0167622_1003748); c00450_3300015.. (original name was: 3300015158.a:Ga0167622_1002920); c00451_3300015.. (original name was: 3300015158.a:Ga0167622_1000451); c00452_3300015.. (original name was: 3300015158.a:Ga0167622_1004566); c00454_3300015.. (original name was: 3300015158.a:Ga0167622_1000471); c00455_3300015.. (original name was: 3300015158.a:Ga0167622_1004146); c00456_3300015.. (original name was: 3300015158.a:Ga0167622_1002834); c00457_3300015.. (original name was: 3300015158.a:Ga0167622_1000365); c00458_3300015.. (original name was: 3300015158.a:Ga0167622_1000680); c00459_3300015.. (original name was: 3300015158.a:Ga0167622_1001265); c00460_3300015.. (original name was: 3300015158.a:Ga0167622_1007026); c00461_3300015.. (original name was: 3300015158.a:Ga0167622_1000442); c00462_3300015.. (original name was: 3300015158.a:Ga0167622_1002889); c00463_3300015.. (original name was: 3300015158.a:Ga0167622_1007004); c00464_3300015.. (original name was: 3300015158.a:Ga0167622_1000420); c00465_3300015.. (original name was: 3300015158.a:Ga0167622_1002706); c00466_3300015.. (original name was: 3300015158.a:Ga0167622_1000661); c00467_3300015.. (original name was: 3300015158.a:Ga0167622_1000517); c00468_3300015.. (original name was: 3300015158.a:Ga0167622_1000430); c00469_3300015.. (original name was: 3300015158.a:Ga0167622_1004545); c00470_3300015.. (original name was: 3300015158.a:Ga0167622_1002065); c00471_3300015.. (original name was: 3300015158.a:Ga0167622_1004524); c00472_3300015.. (original name was: 3300015158.a:Ga0167622_1003701); c00473_3300015.. (original name was: 3300015158.a:Ga0167622_1000390); c00474_3300015.. (original name was: 3300015158.a:Ga0167622_1001213); c00475_3300015.. (original name was: 3300015158.a:Ga0167622_1002859); c00476_3300015.. (original name was: 3300015158.a:Ga0167622_1002460); c00478_3300015.. (original name was: 3300015158.a:Ga0167622_1004728); c00479_3300015.. (original name was: 3300015158.a:Ga0167622_1006374); c00480_3300015.. (original name was: 3300015158.a:Ga0167622_1002259); c00481_3300015.. (original name was: 3300015158.a:Ga0167622_1000269); c00482_3300015.. (original name was: 3300015158.a:Ga0167622_1001007); c00484_3300015.. (original name was: 3300015158.a:Ga0167622_1001446); c00485_3300015.. (original name was: 3300015158.a:Ga0167622_1002315); c00486_3300015.. (original name was: 3300015158.a:Ga0167622_1001492); c00487_3300015.. (original name was: 3300015158.a:Ga0167622_1006972); c00488_3300015.. (original name was: 3300015158.a:Ga0167622_1000388); c00489_3300015.. (original name was: 3300015158.a:Ga0167622_1002314); c00490_3300015.. (original name was: 3300015158.a:Ga0167622_1003960); c00491_3300015.. (original name was: 3300015158.a:Ga0167622_1001329); c00492_3300015.. (original name was: 3300015158.a:Ga0167622_1000321); c00493_3300015.. (original name was: 3300015158.a:Ga0167622_1002926); c00494_3300015.. (original name was: 3300015158.a:Ga0167622_1000457); c00495_3300015.. (original name was: 3300015158.a:Ga0167622_1001897); c00496_3300015.. (original name was: 3300015158.a:Ga0167622_1002968); c00497_3300015.. (original name was: 3300015158.a:Ga0167622_1002145); c00498_3300015.. (original name was: 3300015158.a:Ga0167622_1000499); c00499_3300015.. (original name was: 3300015158.a:Ga0167622_1004589); c00500_3300015.. (original name was: 3300015158.a:Ga0167622_1003751); c00501_3300015.. (original name was: 3300015158.a:Ga0167622_1002105); c00502_3300015.. (original name was: 3300015158.a:Ga0167622_1007043); c00503_3300015.. (original name was: 3300015158.a:Ga0167622_1000459); c00504_3300015.. (original name was: 3300015158.a:Ga0167622_1007036); c00505_3300015.. (original name was: 3300015158.a:Ga0167622_1000452); c00506_3300015.. (original name was: 3300015158.a:Ga0167622_1000646); c00507_3300015.. (original name was: 3300015158.a:Ga0167622_1000909); c00509_3300015.. (original name was: 3300015158.a:Ga0167622_1002232); c00510_3300015.. (original name was: 3300015158.a:Ga0167622_1006347); c00511_3300015.. (original name was: 3300015158.a:Ga0167622_1004428); c00512_3300015.. (original name was: 3300015158.a:Ga0167622_1001959); c00513_3300015.. (original name was: 3300015158.a:Ga0167622_1003858); c00514_3300015.. (original name was: 3300015158.a:Ga0167622_1000566); c00515_3300015.. (original name was: 3300015158.a:Ga0167622_1001514); c00518_3300015.. (original name was: 3300015158.a:Ga0167622_1000806); c00519_3300015.. (original name was: 3300015158.a:Ga0167622_1002452); c00520_3300015.. (original name was: 3300015158.a:Ga0167622_1001231); c00521_3300015.. (original name was: 3300015158.a:Ga0167622_1003700); c00522_3300015.. (original name was: 3300015158.a:Ga0167622_1000408); c00523_3300015.. (original name was: 3300015158.a:Ga0167622_1004109); c00524_3300015.. (original name was: 3300015158.a:Ga0167622_1000817); c00525_3300015.. (original name was: 3300015158.a:Ga0167622_1000791)

Compact view

c00010_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 12,567 nt. (total: 12,567 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00011_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 14,798 nt. (total: 14,798 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 14798:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_1

CAL_domain (40..486): pk

minowa: NH2

Prediction, score:

NH2: 225.1
fatty_acid: 30.6
AHBA: 17.3
Acetyl-CoA: 7.5
shikimic_acid: 4.1

ctg11_7

Search NORINE for peptide: strict or relaxed

AMP-binding (506..904): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

c00021_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,392 nt. (total: 5,392 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5392:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_2

Search NORINE for peptide: strict or relaxed

AMP-binding (681..1077): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGlTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

c00023_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 11,829 nt. (total: 11,829 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 11829:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_6

Search NORINE for peptide: strict or relaxed

AMP-binding (297..698): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1358..1747): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DvFNNgLTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

c00050_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 12,058 nt. (total: 12,058 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 12058:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg50_1

CAL_domain (44..329): pk

minowa: NH2

Prediction, score:

NH2: 150.1
fatty_acid: 26.1
AHBA: 14.6
Acetyl-CoA: 4.5
shikimic_acid: 0.0

ctg50_8

Search NORINE for peptide: strict or relaxed

AMP-binding (267..667): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00058_3300015.. - Region 1 - ladderane

Download region GenBank file

Location: 1 - 6,120 nt. (total: 6,120 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00071_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,951 nt. (total: 6,951 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00101_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 10,962 nt. (total: 10,962 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10962:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg101_5

Search NORINE for peptide: strict or relaxed

AMP-binding (145..543): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNtALTfK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 80% (moderate)

AMP-binding (1208..1613): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVrHFaLlaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 60% (weak)

c00110_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,955 nt. (total: 3,955 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3955:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg110_1

Search NORINE for peptide: strict or relaxed

AMP-binding (7..288): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00124_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,811 nt. (total: 5,811 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg124_1

Search NORINE for peptide: strict or relaxed

AMP-binding (511..918): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1589..1838): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: N/A
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DAYi-----K
Nearest Stachelhaus code:: val
Stachelhaus code match:: 40% (weak)

c00131_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,622 nt. (total: 7,622 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7622:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg131_1

Search NORINE for peptide: strict or relaxed

AMP-binding (460..852): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGlTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

AMP-binding (1513..1908): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGlTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

c00149_3300015.. - Region 1 - terpene

Download region GenBank file

Location: 1 - 6,771 nt. (total: 6,771 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00152_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,159 nt. (total: 7,159 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7159:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro - leu) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg152_1

Search NORINE for peptide: strict or relaxed

AMP-binding (114..518): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHVaK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (1177..1570): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFvGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

ctg152_2

Search NORINE for peptide: strict or relaxed

AMP-binding (60..456): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvwlTGiVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

c00177_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 9,648 nt. (total: 9,648 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9648:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - leu - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg177_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..335): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (986..1377): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGcVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

AMP-binding (2034..2433): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeDVGAIsK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 80% (moderate)

c00179_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,593 nt. (total: 3,593 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3593:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg179_1

Search NORINE for peptide: strict or relaxed

AMP-binding (380..785): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00184_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 8,769 nt. (total: 8,769 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg184_1

Search NORINE for peptide: strict or relaxed

AMP-binding (503..891): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

AMP-binding (1542..1942): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeDVGAIsK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 80% (moderate)

AMP-binding (2598..2919): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGcVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

c00198_3300015.. - Region 1 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 1 - 25,745 nt. (total: 25,745 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg198_13 - Putative Class I

ctg198_14 leader / core peptide: MMSEKNNQENQAEMENLEIEPLSDEDLESVPG - GDhbLDhaQFEDCDhaCGDhaDhbGGNCDhbA

Lanthipeptide(s) for ctg198_16 - Putative Class I

ctg198_14 leader / core peptide: MMSEKNNQENQAEMENLEIEPLSDEDLESVPG - GDhbLDhaQFEDCDhaCGDhaDhbGGNCDhbA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg198_14 - Class I

Cleavage pHMM score: -12.40

RODEO score: 14

Monoisotopic mass: 1828.7 Da

Molecular weight: 1829.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1847.9 Da N = 1; 1866.0 Da N = 2; 1884.0 Da N = 3

ctg198_14 - Class I

Cleavage pHMM score: -12.40

RODEO score: 14

Monoisotopic mass: 1828.7 Da

Molecular weight: 1829.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1847.9 Da N = 1; 1866.0 Da N = 2; 1884.0 Da N = 3

c00224_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,976 nt. (total: 6,976 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6976:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg224_2

Search NORINE for peptide: strict or relaxed

AMP-binding (1171..1564): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DlLWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00233_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,054 nt. (total: 6,054 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6054:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg233_1

Search NORINE for peptide: strict or relaxed

AMP-binding (557..955): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (1617..2017): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

c00234_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,395 nt. (total: 6,395 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6395:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg234_2

Search NORINE for peptide: strict or relaxed

AMP-binding (513..910): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00238_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,122 nt. (total: 6,122 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6122:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg238_1

Search NORINE for peptide: strict or relaxed

AMP-binding (820..1213): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00239_3300015.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 3,860 nt. (total: 3,860 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00253_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,252 nt. (total: 4,252 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg253_1

Search NORINE for peptide: strict or relaxed

AMP-binding (449..836): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVlHFGvIvK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 70% (weak)

c00259_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,994 nt. (total: 3,994 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg259_1

Search NORINE for peptide: strict or relaxed

AMP-binding (622..1028): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DpLWLGGcFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

c00266_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,033 nt. (total: 13,033 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - ser - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg266_1

Search NORINE for peptide: strict or relaxed

AMP-binding (276..690): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

AMP-binding (1351..1741): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (2403..2809): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3464..3865): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLedIGgVtK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 60% (weak)

c00271_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,613 nt. (total: 3,613 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3613:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg271_1

Search NORINE for peptide: strict or relaxed

AMP-binding (251..656): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIeK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

c00290_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 8,519 nt. (total: 8,519 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8519:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg290_1

Search NORINE for peptide: strict or relaxed

AMP-binding (529..940): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeVtAddK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

AMP-binding (1604..1999): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DmlqFGmVYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 60% (weak)

c00299_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,197 nt. (total: 4,197 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4197:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg299_1

Search NORINE for peptide: strict or relaxed

AMP-binding (27..299): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (957..1354): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DtfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

c00301_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,224 nt. (total: 5,224 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5224:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg301_1

Search NORINE for peptide: strict or relaxed

AMP-binding (456..848): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1505..1741): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIL------K
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 40% (weak)

c00312_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 9,584 nt. (total: 9,584 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9584:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg312_1

Search NORINE for peptide: strict or relaxed

AMP-binding (1234..1640): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDtGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

c00318_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,018 nt. (total: 3,018 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00331_3300015.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 5,312 nt. (total: 5,312 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5312:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg331_1

Search NORINE for peptide: strict or relaxed

AMP-binding (245..669): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

PKS_AT (1402..1705): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.6
inactive: 113.9
Methoxymalonyl-CoA: 74.5
Methylmalonyl-CoA: 73.3
Ethylmalonyl-CoA: 49.6
Propionyl-CoA: 47.1
Isobutyryl-CoA: 32.1
Benzoyl-CoA: 26.8
CHC-CoA: 24.8
2-Methylbutyryl-CoA: 24.6
Acetyl-CoA: 20.3
trans-1,2-CPDA: 18.6
fatty_acid: 16.1
3-Methylbutyryl-CoA: 0.0

c00334_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,578 nt. (total: 7,578 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7578:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg334_3

Search NORINE for peptide: strict or relaxed

AMP-binding (858..1262): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVtK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

c00342_3300015.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 3,389 nt. (total: 3,389 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3389:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg342_1

Search NORINE for peptide: strict or relaxed

AMP-binding (1..382): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLafvWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

c00350_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,400 nt. (total: 4,400 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4400:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg350_1

Search NORINE for peptide: strict or relaxed

AMP-binding (603..994): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

c00367_3300015.. - Region 1 - bacteriocin

Download region GenBank file

Location: 6,589 - 17,426 nt. (total: 10,838 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00385_3300015.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 4,472 nt. (total: 4,472 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00390_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 15,930 nt. (total: 15,930 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 15930:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg390_1

Search NORINE for peptide: strict or relaxed

CAL_domain (37..481): pk

minowa: NH2

Prediction, score:

NH2: 26.7
fatty_acid: 25.4
AHBA: 15.6
Acetyl-CoA: 3.5
shikimic_acid: -0.2

AMP-binding (1152..1549): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (2209..2615): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIesVAtiIK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 60% (weak)

c00400_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,165 nt. (total: 4,165 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4165:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg400_2

Search NORINE for peptide: strict or relaxed

AMP-binding (38..435): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFnnGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 70% (weak)

c00440_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 45,622 nt. (total: 45,622 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 45622:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - thr) + (gln - asn) + (X - D-asp) + (X - X) + (gln - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg440_1

Search NORINE for peptide: strict or relaxed

AMP-binding (0..302): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (964..1369): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNlGlVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 80% (moderate)

ctg440_2

Search NORINE for peptide: strict or relaxed

AMP-binding (465..863): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1804..2200): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg440_4

Search NORINE for peptide: strict or relaxed

AMP-binding (458..862): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

AMP-binding (1820..2208): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg440_5

Search NORINE for peptide: strict or relaxed

AMP-binding (474..870): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (1882..2285): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAehIGAItK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg440_6

Search NORINE for peptide: strict or relaxed

AMP-binding (469..868): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAWQFGLIDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1529..1940): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

ctg440_8

Search NORINE for peptide: strict or relaxed

AMP-binding (468..872): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

c00453_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,937 nt. (total: 4,937 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4937:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg453_2

Search NORINE for peptide: strict or relaxed

AMP-binding (486..887): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00477_3300015.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 13,661 nt. (total: 13,661 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg477_9 - Putative Class II

ctg477_10 leader / core peptide: MKTVDPIRAWKDPVYRASLSAEEQAQLPSHPSGILNLDEEQLKLAAG - GAIPRDhbDhbYRDhbCDhbEYDhbDhaRDhbGCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg477_10 - Class II

Cleavage pHMM score: -3.10

RODEO score: 0

Monoisotopic mass: 2213.0 Da

Molecular weight: 2214.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2232.5 Da N = 1; 2250.5 Da N = 2; 2268.5 Da N = 3; 2286.6 Da N = 4

c00483_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,534 nt. (total: 3,534 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3534:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg483_1

Search NORINE for peptide: strict or relaxed

AMP-binding (612..1004): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DmFdnGlTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 60% (weak)

c00508_3300015.. - Region 1 - T3PKS

Download region GenBank file

Location: 1 - 16,625 nt. (total: 16,625 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00516_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 10,847 nt. (total: 10,847 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 10847:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - leu - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg516_2

Search NORINE for peptide: strict or relaxed

AMP-binding (266..665): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DIFHfGLiiK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (1330..1730): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFvGhVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 80% (moderate)

AMP-binding (2391..2794): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvWFvGiVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

c00517_3300015.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 22,587 nt. (total: 22,587 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 22587:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - asp - ser - asn - asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg517_7

Search NORINE for peptide: strict or relaxed

AMP-binding (504..904): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1567..1971): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DsTKIGnVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (2633..3031): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3690..4094): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DsTKIGnVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (4750..5153): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DsTKIGnVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)