3300018910_4 - 29 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300018.. (original name was: 3300018910.a:Ga0193598_1009080)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS-like	1	3,086

c00003_3300018.. (original name was: 3300018910.a:Ga0193598_1006560)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	bacteriocin	1	4,003

c00015_3300018.. (original name was: 3300018910.a:Ga0193598_1006178)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS	1	4,200

c00023_3300018.. (original name was: 3300018910.a:Ga0193598_1001712)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	T1PKS,NRPS	1	13,770

c00026_3300018.. (original name was: 3300018910.a:Ga0193598_1000042)

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	LAP,TfuA-related	15,262	50,058

c00028_3300018.. (original name was: 3300018910.a:Ga0193598_1003503)

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	NRPS	1	6,951

c00035_3300018.. (original name was: 3300018910.a:Ga0193598_1002825)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	bacteriocin	1	7,211

c00044_3300018.. (original name was: 3300018910.a:Ga0193598_1000147)

Region	Type	From	To	Most similar known cluster		Similarity
Region 44.1	NRPS	5,802	50,028

c00056_3300018.. (original name was: 3300018910.a:Ga0193598_1000015)

Region	Type	From	To	Most similar known cluster		Similarity
Region 56.1	terpene	98,071	119,042

c00059_3300018.. (original name was: 3300018910.a:Ga0193598_1000016)

Region	Type	From	To	Most similar known cluster		Similarity
Region 59.1	proteusin	205,998	227,435

c00062_3300018.. (original name was: 3300018910.a:Ga0193598_1001020)

Region	Type	From	To	Most similar known cluster		Similarity
Region 62.1	T1PKS	1	21,856

c00069_3300018.. (original name was: 3300018910.a:Ga0193598_1003978)

Region	Type	From	To	Most similar known cluster		Similarity
Region 69.1	lassopeptide	1	6,182

c00072_3300018.. (original name was: 3300018910.a:Ga0193598_1003501)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	lanthipeptide	1	6,955

c00100_3300018.. (original name was: 3300018910.a:Ga0193598_1005914)

Region	Type	From	To	Most similar known cluster		Similarity
Region 100.1	NRPS	1	4,354

c00112_3300018.. (original name was: 3300018910.a:Ga0193598_1000031)

Region	Type	From	To	Most similar known cluster		Similarity
Region 112.1	hglE-KS	1	45,394

c00126_3300018.. (original name was: 3300018910.a:Ga0193598_1006368)

Region	Type	From	To	Most similar known cluster		Similarity
Region 126.1	NRPS-like	1	4,104

c00135_3300018.. (original name was: 3300018910.a:Ga0193598_1000279)

Region	Type	From	To	Most similar known cluster		Similarity
Region 135.1	NRPS	1	50,590

c00146_3300018.. (original name was: 3300018910.a:Ga0193598_1000112)

Region	Type	From	To	Most similar known cluster		Similarity
Region 146.1	NRPS	8,627	56,836

c00147_3300018.. (original name was: 3300018910.a:Ga0193598_1000041)

Region	Type	From	To	Most similar known cluster		Similarity
Region 147.1	lassopeptide	125,521	139,257

c00149_3300018.. (original name was: 3300018910.a:Ga0193598_1005613)

Region	Type	From	To	Most similar known cluster		Similarity
Region 149.1	NRPS	1	4,549

c00151_3300018.. (original name was: 3300018910.a:Ga0193598_1000239)

Region	Type	From	To	Most similar known cluster		Similarity
Region 151.1	NRPS,betalactone	13,275	54,813

c00153_3300018.. (original name was: 3300018910.a:Ga0193598_1004466)

Region	Type	From	To	Most similar known cluster		Similarity
Region 153.1	lanthipeptide	1	5,570

c00157_3300018.. (original name was: 3300018910.a:Ga0193598_1007182)

Region	Type	From	To	Most similar known cluster		Similarity
Region 157.1	NRPS	1	3,712

c00177_3300018.. (original name was: 3300018910.a:Ga0193598_1000274)

Region	Type	From	To	Most similar known cluster		Similarity
Region 177.1	terpene	28,637	49,566

c00184_3300018.. (original name was: 3300018910.a:Ga0193598_1000014)

Region	Type	From	To	Most similar known cluster		Similarity
Region 184.1	NRPS-like	11,363	54,041

c00195_3300018.. (original name was: 3300018910.a:Ga0193598_1006034)

Region	Type	From	To	Most similar known cluster		Similarity
Region 195.1	NRPS	1	4,274

c00196_3300018.. (original name was: 3300018910.a:Ga0193598_1006307)

Region	Type	From	To	Most similar known cluster		Similarity
Region 196.1	NRPS	1	4,130

c00201_3300018.. (original name was: 3300018910.a:Ga0193598_1000736)

Region	Type	From	To	Most similar known cluster		Similarity
Region 201.1	NRPS,T1PKS	1	28,194

c00204_3300018.. (original name was: 3300018910.a:Ga0193598_1000764)

Region	Type	From	To	Most similar known cluster		Similarity
Region 204.1	NRPS	1	27,534

Region	Type	From	To	Similarity
Region 1.1	NRPS-like	1	3,086
Region 3.1	bacteriocin	1	4,003
Region 15.1	NRPS	1	4,200
Region 23.1	T1PKS,NRPS	1	13,770
Region 26.1	LAP,TfuA-related	15,262	50,058
Region 28.1	NRPS	1	6,951
Region 35.1	bacteriocin	1	7,211
Region 44.1	NRPS	5,802	50,028
Region 56.1	terpene	98,071	119,042
Region 59.1	proteusin	205,998	227,435
Region 62.1	T1PKS	1	21,856
Region 69.1	lassopeptide	1	6,182
Region 72.1	lanthipeptide	1	6,955
Region 100.1	NRPS	1	4,354
Region 112.1	hglE-KS	1	45,394
Region 126.1	NRPS-like	1	4,104
Region 135.1	NRPS	1	50,590
Region 146.1	NRPS	8,627	56,836
Region 147.1	lassopeptide	125,521	139,257
Region 149.1	NRPS	1	4,549
Region 151.1	NRPS,betalactone	13,275	54,813
Region 153.1	lanthipeptide	1	5,570
Region 157.1	NRPS	1	3,712
Region 177.1	terpene	28,637	49,566
Region 184.1	NRPS-like	11,363	54,041
Region 195.1	NRPS	1	4,274
Region 196.1	NRPS	1	4,130
Region 201.1	NRPS,T1PKS	1	28,194
Region 204.1	NRPS	1	27,534

No secondary metabolite regions were found in these records:: c00002_3300018.. (original name was: 3300018910.a:Ga0193598_1007022); c00004_3300018.. (original name was: 3300018910.a:Ga0193598_1006448); c00005_3300018.. (original name was: 3300018910.a:Ga0193598_1004187); c00006_3300018.. (original name was: 3300018910.a:Ga0193598_1004005); c00007_3300018.. (original name was: 3300018910.a:Ga0193598_1003571); c00008_3300018.. (original name was: 3300018910.a:Ga0193598_1000059); c00009_3300018.. (original name was: 3300018910.a:Ga0193598_1000356); c00010_3300018.. (original name was: 3300018910.a:Ga0193598_1001552); c00011_3300018.. (original name was: 3300018910.a:Ga0193598_1000258); c00012_3300018.. (original name was: 3300018910.a:Ga0193598_1001489); c00013_3300018.. (original name was: 3300018910.a:Ga0193598_1000393); c00014_3300018.. (original name was: 3300018910.a:Ga0193598_1000705); c00016_3300018.. (original name was: 3300018910.a:Ga0193598_1003246); c00017_3300018.. (original name was: 3300018910.a:Ga0193598_1003345); c00018_3300018.. (original name was: 3300018910.a:Ga0193598_1000173); c00019_3300018.. (original name was: 3300018910.a:Ga0193598_1005746); c00020_3300018.. (original name was: 3300018910.a:Ga0193598_1009293); c00021_3300018.. (original name was: 3300018910.a:Ga0193598_1009272); c00022_3300018.. (original name was: 3300018910.a:Ga0193598_1008677); c00024_3300018.. (original name was: 3300018910.a:Ga0193598_1003006); c00025_3300018.. (original name was: 3300018910.a:Ga0193598_1006809); c00027_3300018.. (original name was: 3300018910.a:Ga0193598_1007781); c00029_3300018.. (original name was: 3300018910.a:Ga0193598_1005443); c00030_3300018.. (original name was: 3300018910.a:Ga0193598_1004347); c00031_3300018.. (original name was: 3300018910.a:Ga0193598_1004855); c00032_3300018.. (original name was: 3300018910.a:Ga0193598_1004743); c00033_3300018.. (original name was: 3300018910.a:Ga0193598_1001766); c00034_3300018.. (original name was: 3300018910.a:Ga0193598_1003826); c00036_3300018.. (original name was: 3300018910.a:Ga0193598_1005710); c00037_3300018.. (original name was: 3300018910.a:Ga0193598_1001978); c00038_3300018.. (original name was: 3300018910.a:Ga0193598_1000585); c00039_3300018.. (original name was: 3300018910.a:Ga0193598_1001230); c00040_3300018.. (original name was: 3300018910.a:Ga0193598_1001329); c00041_3300018.. (original name was: 3300018910.a:Ga0193598_1001428); c00042_3300018.. (original name was: 3300018910.a:Ga0193598_1001705); c00043_3300018.. (original name was: 3300018910.a:Ga0193598_1001243); c00045_3300018.. (original name was: 3300018910.a:Ga0193598_1001096); c00046_3300018.. (original name was: 3300018910.a:Ga0193598_1000753); c00047_3300018.. (original name was: 3300018910.a:Ga0193598_1003638); c00048_3300018.. (original name was: 3300018910.a:Ga0193598_1000389); c00049_3300018.. (original name was: 3300018910.a:Ga0193598_1003296); c00050_3300018.. (original name was: 3300018910.a:Ga0193598_1000326); c00051_3300018.. (original name was: 3300018910.a:Ga0193598_1000046); c00052_3300018.. (original name was: 3300018910.a:Ga0193598_1001160); c00053_3300018.. (original name was: 3300018910.a:Ga0193598_1004840); c00054_3300018.. (original name was: 3300018910.a:Ga0193598_1001057); c00055_3300018.. (original name was: 3300018910.a:Ga0193598_1004149); c00057_3300018.. (original name was: 3300018910.a:Ga0193598_1004042); c00058_3300018.. (original name was: 3300018910.a:Ga0193598_1001699); c00060_3300018.. (original name was: 3300018910.a:Ga0193598_1000108); c00061_3300018.. (original name was: 3300018910.a:Ga0193598_1000504); c00063_3300018.. (original name was: 3300018910.a:Ga0193598_1000341); c00064_3300018.. (original name was: 3300018910.a:Ga0193598_1000337); c00065_3300018.. (original name was: 3300018910.a:Ga0193598_1004952); c00066_3300018.. (original name was: 3300018910.a:Ga0193598_1001152); c00067_3300018.. (original name was: 3300018910.a:Ga0193598_1004160); c00068_3300018.. (original name was: 3300018910.a:Ga0193598_1000541); c00070_3300018.. (original name was: 3300018910.a:Ga0193598_1008103); c00071_3300018.. (original name was: 3300018910.a:Ga0193598_1002277); c00073_3300018.. (original name was: 3300018910.a:Ga0193598_1000324); c00074_3300018.. (original name was: 3300018910.a:Ga0193598_1001650); c00075_3300018.. (original name was: 3300018910.a:Ga0193598_1000065); c00076_3300018.. (original name was: 3300018910.a:Ga0193598_1000054); c00077_3300018.. (original name was: 3300018910.a:Ga0193598_1001157); c00078_3300018.. (original name was: 3300018910.a:Ga0193598_1000351); c00079_3300018.. (original name was: 3300018910.a:Ga0193598_1007369); c00080_3300018.. (original name was: 3300018910.a:Ga0193598_1005812); c00081_3300018.. (original name was: 3300018910.a:Ga0193598_1000460); c00082_3300018.. (original name was: 3300018910.a:Ga0193598_1000353); c00083_3300018.. (original name was: 3300018910.a:Ga0193598_1000012); c00084_3300018.. (original name was: 3300018910.a:Ga0193598_1000309); c00085_3300018.. (original name was: 3300018910.a:Ga0193598_1003502); c00086_3300018.. (original name was: 3300018910.a:Ga0193598_1000107); c00087_3300018.. (original name was: 3300018910.a:Ga0193598_1003183); c00088_3300018.. (original name was: 3300018910.a:Ga0193598_1001507); c00089_3300018.. (original name was: 3300018910.a:Ga0193598_1000122); c00090_3300018.. (original name was: 3300018910.a:Ga0193598_1000513); c00091_3300018.. (original name was: 3300018910.a:Ga0193598_1007422); c00092_3300018.. (original name was: 3300018910.a:Ga0193598_1000549); c00093_3300018.. (original name was: 3300018910.a:Ga0193598_1001311); c00094_3300018.. (original name was: 3300018910.a:Ga0193598_1000033); c00095_3300018.. (original name was: 3300018910.a:Ga0193598_1004881); c00096_3300018.. (original name was: 3300018910.a:Ga0193598_1000304); c00097_3300018.. (original name was: 3300018910.a:Ga0193598_1003250); c00098_3300018.. (original name was: 3300018910.a:Ga0193598_1005287); c00099_3300018.. (original name was: 3300018910.a:Ga0193598_1000045); c00101_3300018.. (original name was: 3300018910.a:Ga0193598_1000080); c00102_3300018.. (original name was: 3300018910.a:Ga0193598_1005850); c00103_3300018.. (original name was: 3300018910.a:Ga0193598_1000325); c00104_3300018.. (original name was: 3300018910.a:Ga0193598_1000359); c00105_3300018.. (original name was: 3300018910.a:Ga0193598_1003075); c00106_3300018.. (original name was: 3300018910.a:Ga0193598_1004972); c00107_3300018.. (original name was: 3300018910.a:Ga0193598_1002666); c00108_3300018.. (original name was: 3300018910.a:Ga0193598_1002773); c00109_3300018.. (original name was: 3300018910.a:Ga0193598_1000795); c00110_3300018.. (original name was: 3300018910.a:Ga0193598_1006565); c00111_3300018.. (original name was: 3300018910.a:Ga0193598_1001092); c00113_3300018.. (original name was: 3300018910.a:Ga0193598_1001516); c00114_3300018.. (original name was: 3300018910.a:Ga0193598_1000420); c00115_3300018.. (original name was: 3300018910.a:Ga0193598_1001813); c00116_3300018.. (original name was: 3300018910.a:Ga0193598_1002133); c00117_3300018.. (original name was: 3300018910.a:Ga0193598_1000048); c00118_3300018.. (original name was: 3300018910.a:Ga0193598_1001319); c00119_3300018.. (original name was: 3300018910.a:Ga0193598_1001616); c00120_3300018.. (original name was: 3300018910.a:Ga0193598_1000219); c00121_3300018.. (original name was: 3300018910.a:Ga0193598_1006152); c00122_3300018.. (original name was: 3300018910.a:Ga0193598_1001739); c00123_3300018.. (original name was: 3300018910.a:Ga0193598_1000841); c00124_3300018.. (original name was: 3300018910.a:Ga0193598_1000689); c00125_3300018.. (original name was: 3300018910.a:Ga0193598_1000796); c00127_3300018.. (original name was: 3300018910.a:Ga0193598_1006467); c00128_3300018.. (original name was: 3300018910.a:Ga0193598_1001760); c00129_3300018.. (original name was: 3300018910.a:Ga0193598_1002824); c00130_3300018.. (original name was: 3300018910.a:Ga0193598_1002658); c00131_3300018.. (original name was: 3300018910.a:Ga0193598_1000169); c00132_3300018.. (original name was: 3300018910.a:Ga0193598_1007421); c00133_3300018.. (original name was: 3300018910.a:Ga0193598_1002966); c00134_3300018.. (original name was: 3300018910.a:Ga0193598_1000072); c00136_3300018.. (original name was: 3300018910.a:Ga0193598_1003218); c00137_3300018.. (original name was: 3300018910.a:Ga0193598_1003512); c00138_3300018.. (original name was: 3300018910.a:Ga0193598_1008378); c00139_3300018.. (original name was: 3300018910.a:Ga0193598_1006865); c00140_3300018.. (original name was: 3300018910.a:Ga0193598_1000098); c00141_3300018.. (original name was: 3300018910.a:Ga0193598_1001277); c00142_3300018.. (original name was: 3300018910.a:Ga0193598_1000006); c00143_3300018.. (original name was: 3300018910.a:Ga0193598_1000013); c00144_3300018.. (original name was: 3300018910.a:Ga0193598_1004100); c00145_3300018.. (original name was: 3300018910.a:Ga0193598_1005585); c00148_3300018.. (original name was: 3300018910.a:Ga0193598_1004021); c00150_3300018.. (original name was: 3300018910.a:Ga0193598_1005965); c00152_3300018.. (original name was: 3300018910.a:Ga0193598_1000090); c00154_3300018.. (original name was: 3300018910.a:Ga0193598_1000118); c00155_3300018.. (original name was: 3300018910.a:Ga0193598_1000217); c00156_3300018.. (original name was: 3300018910.a:Ga0193598_1002834); c00158_3300018.. (original name was: 3300018910.a:Ga0193598_1000125); c00159_3300018.. (original name was: 3300018910.a:Ga0193598_1000216); c00160_3300018.. (original name was: 3300018910.a:Ga0193598_1000200); c00161_3300018.. (original name was: 3300018910.a:Ga0193598_1000414); c00162_3300018.. (original name was: 3300018910.a:Ga0193598_1000251); c00163_3300018.. (original name was: 3300018910.a:Ga0193598_1000937); c00164_3300018.. (original name was: 3300018910.a:Ga0193598_1005185); c00165_3300018.. (original name was: 3300018910.a:Ga0193598_1001051); c00166_3300018.. (original name was: 3300018910.a:Ga0193598_1000944); c00167_3300018.. (original name was: 3300018910.a:Ga0193598_1000822); c00168_3300018.. (original name was: 3300018910.a:Ga0193598_1002414); c00169_3300018.. (original name was: 3300018910.a:Ga0193598_1001088); c00170_3300018.. (original name was: 3300018910.a:Ga0193598_1002680); c00171_3300018.. (original name was: 3300018910.a:Ga0193598_1002764); c00172_3300018.. (original name was: 3300018910.a:Ga0193598_1003576); c00173_3300018.. (original name was: 3300018910.a:Ga0193598_1002282); c00174_3300018.. (original name was: 3300018910.a:Ga0193598_1007854); c00175_3300018.. (original name was: 3300018910.a:Ga0193598_1003783); c00176_3300018.. (original name was: 3300018910.a:Ga0193598_1005375); c00178_3300018.. (original name was: 3300018910.a:Ga0193598_1000075); c00179_3300018.. (original name was: 3300018910.a:Ga0193598_1001667); c00180_3300018.. (original name was: 3300018910.a:Ga0193598_1000191); c00181_3300018.. (original name was: 3300018910.a:Ga0193598_1006124); c00182_3300018.. (original name was: 3300018910.a:Ga0193598_1006824); c00183_3300018.. (original name was: 3300018910.a:Ga0193598_1008504); c00185_3300018.. (original name was: 3300018910.a:Ga0193598_1000185); c00186_3300018.. (original name was: 3300018910.a:Ga0193598_1000399); c00187_3300018.. (original name was: 3300018910.a:Ga0193598_1000833); c00188_3300018.. (original name was: 3300018910.a:Ga0193598_1009271); c00189_3300018.. (original name was: 3300018910.a:Ga0193598_1000896); c00190_3300018.. (original name was: 3300018910.a:Ga0193598_1001785); c00191_3300018.. (original name was: 3300018910.a:Ga0193598_1002968); c00192_3300018.. (original name was: 3300018910.a:Ga0193598_1003661); c00193_3300018.. (original name was: 3300018910.a:Ga0193598_1003864); c00194_3300018.. (original name was: 3300018910.a:Ga0193598_1003948); c00197_3300018.. (original name was: 3300018910.a:Ga0193598_1002227); c00198_3300018.. (original name was: 3300018910.a:Ga0193598_1000036); c00199_3300018.. (original name was: 3300018910.a:Ga0193598_1000162); c00200_3300018.. (original name was: 3300018910.a:Ga0193598_1003492); c00202_3300018.. (original name was: 3300018910.a:Ga0193598_1007654); c00203_3300018.. (original name was: 3300018910.a:Ga0193598_1000450); c00205_3300018.. (original name was: 3300018910.a:Ga0193598_1001030); c00206_3300018.. (original name was: 3300018910.a:Ga0193598_1003375)

Compact view

c00001_3300018.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 3,086 nt. (total: 3,086 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00003_3300018.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 4,003 nt. (total: 4,003 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00015_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,200 nt. (total: 4,200 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4200:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_1

Search NORINE for peptide: strict or relaxed

AMP-binding (509..905): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00023_3300018.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 13,770 nt. (total: 13,770 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13770:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_8

CAL_domain (51..497): pk

minowa: NH2

Prediction, score:

NH2: 230.0
fatty_acid: 17.0
AHBA: 12.4
Acetyl-CoA: 3.3
shikimic_acid: 0.0

PKS_AT (1269..1592): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.8
inactive: 151.2
Methoxymalonyl-CoA: 56.7
Methylmalonyl-CoA: 50.7
Propionyl-CoA: 39.7
Isobutyryl-CoA: 30.3
Ethylmalonyl-CoA: 28.4
Acetyl-CoA: 25.0
Benzoyl-CoA: 24.6
2-Methylbutyryl-CoA: 20.4
CHC-CoA: 17.0
trans-1,2-CPDA: 15.3
fatty_acid: 11.4
3-Methylbutyryl-CoA: 0.0

c00026_3300018.. - Region 1 - LAP,TfuA-related

Download region GenBank file

Location: 15,262 - 50,058 nt. (total: 34,797 nt) Show pHMM detection rules used

LAP: ((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882))
TfuA-related: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00028_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,951 nt. (total: 6,951 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6951:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg28_1

Search NORINE for peptide: strict or relaxed

AMP-binding (138..548): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiESIGtVvK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 70% (weak)

AMP-binding (1211..1603): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

c00035_3300018.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 7,211 nt. (total: 7,211 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00044_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 5,802 - 50,028 nt. (total: 44,227 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 5801 - 50028:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg44_23

Search NORINE for peptide: strict or relaxed

AMP-binding (500..908): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFTiAAVwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

c00056_3300018.. - Region 1 - terpene

Download region GenBank file

Location: 98,071 - 119,042 nt. (total: 20,972 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00059_3300018.. - Region 1 - proteusin

Download region GenBank file

Location: 205,998 - 227,435 nt. (total: 21,438 nt) Show pHMM detection rules used

Region on contig edge.

proteusin: PoyD

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00062_3300018.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 21,856 nt. (total: 21,856 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 21856:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg62_13

PKS_AT (563..860): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; CE-Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 129.0
Methoxymalonyl-CoA: 105.7
Malonyl-CoA: 102.3
Ethylmalonyl-CoA: 93.1
Isobutyryl-CoA: 90.6
Benzoyl-CoA: 87.4
Acetyl-CoA: 79.9
Propionyl-CoA: 66.3
trans-1,2-CPDA: 54.7
2-Methylbutyryl-CoA: 52.5
fatty_acid: 43.4
CHC-CoA: 43.4
3-Methylbutyryl-CoA: 42.6
inactive: 29.0

c00069_3300018.. - Region 1 - lassopeptide

Download region GenBank file

Location: 1 - 6,182 nt. (total: 6,182 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

c00072_3300018.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 6,955 nt. (total: 6,955 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg72_2 - Putative Class II

ctg72_5 leader / core peptide: MLNRKQILSMAFLAIGVTMTQTAALASQTTANASSDLTTKPQIVKDCYYAGQKYSEGSVIKGS - DGVQVQCDhaGDRWVLKP
allorf_6664_6846 leader / core peptide: MFYCLDISFSPLNLDCQLWEERSRLARG - CLDhaNLDhbDhaDhbCFDhaALACEPFDWLIGGVFFCYALW

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg72_5 - Class II

Cleavage pHMM score: -2.90

RODEO score: 0

Monoisotopic mass: 1767.9 Da

Molecular weight: 1769.0 Da

Number of bridges: 1

allorf_6664_6846 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 3486.6 Da

Molecular weight: 3489.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3507.1 Da N = 1

c00100_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,354 nt. (total: 4,354 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4354:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg100_1

Search NORINE for peptide: strict or relaxed

AMP-binding (513..912): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00112_3300018.. - Region 1 - hglE-KS

Download region GenBank file

Location: 1 - 45,394 nt. (total: 45,394 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00126_3300018.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 4,104 nt. (total: 4,104 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00135_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 50,590 nt. (total: 50,590 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 50590:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys) + (orn) + (D-asn) + (thr) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg135_3

Search NORINE for peptide: strict or relaxed

AMP-binding (459..866): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg135_5

Search NORINE for peptide: strict or relaxed

AMP-binding (515..923): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg135_6

Search NORINE for peptide: strict or relaxed

AMP-binding (469..874): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg135_8

Search NORINE for peptide: strict or relaxed

AMP-binding (540..956): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg135_9

Search NORINE for peptide: strict or relaxed

AMP-binding (539..940): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNigiIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 70% (weak)

ctg135_13

Search NORINE for peptide: strict or relaxed

AMP-binding (24..414): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: aynfVAGhIK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

c00146_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 8,627 - 56,836 nt. (total: 48,210 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 8626 - 56836:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ile) + (leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg146_24

Search NORINE for peptide: strict or relaxed

AMP-binding (489..900): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg146_25

Search NORINE for peptide: strict or relaxed

AMP-binding (570..977): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00147_3300018.. - Region 1 - lassopeptide

Download region GenBank file

Location: 125,521 - 139,257 nt. (total: 13,737 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

c00149_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,549 nt. (total: 4,549 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4549:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg149_1

Search NORINE for peptide: strict or relaxed

AMP-binding (1..364): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00151_3300018.. - Region 1 - NRPS,betalactone

Download region GenBank file

Location: 13,275 - 54,813 nt. (total: 41,539 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 13274 - 54813:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (tyr - leu) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg151_42

Search NORINE for peptide: strict or relaxed

AMP-binding (539..945): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvevVGnIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 60% (weak)

ctg151_43

Search NORINE for peptide: strict or relaxed

AMP-binding (533..925): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DAgTVgAVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (1587..1983): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg151_44

Search NORINE for peptide: strict or relaxed

AMP-binding (53..445): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWnVGlVCK
Nearest Stachelhaus code:: trp
Stachelhaus code match:: 80% (moderate)

c00153_3300018.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 5,570 nt. (total: 5,570 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg153_1 - Putative Class II

allorf_3962_4201 leader / core peptide: MLYYLTIGGSTFEYNGLFFG - EDhbLNFFDLDDhaFRFRLDhbRNVDhaGNLAFYQVDhaLMLCLDhaPRQLFRDhaDhaWVNRVADhaIQRRDhaLVWF

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_3962_4201 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 6905.7 Da

Molecular weight: 6909.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6927.9 Da N = 1; 6946.0 Da N = 2; 6964.0 Da N = 3; 6982.0 Da N = 4; 7000.0 Da N = 5; 7018.0 Da N = 6; 7036.1 Da N = 7; 7054.1 Da N = 8; 7072.1 Da N = 9

c00157_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,712 nt. (total: 3,712 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00177_3300018.. - Region 1 - terpene

Download region GenBank file

Location: 28,637 - 49,566 nt. (total: 20,930 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00184_3300018.. - Region 1 - NRPS-like

Download region GenBank file

Location: 11,363 - 54,041 nt. (total: 42,679 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 11362 - 54041:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg184_30

Search NORINE for peptide: strict or relaxed

AMP-binding (24..435): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ssRdLsigVK
Nearest Stachelhaus code:: aad
Stachelhaus code match:: 40% (weak)

c00195_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,274 nt. (total: 4,274 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4274:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg195_1

Search NORINE for peptide: strict or relaxed

AMP-binding (537..929): phe

NRPSPredictor2: phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: phe, trp
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: DAWTIAAvCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 90% (moderate)

c00196_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,130 nt. (total: 4,130 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4130:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg196_1

Search NORINE for peptide: strict or relaxed

AMP-binding (378..770): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgtAIAgVCK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

c00201_3300018.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 28,194 nt. (total: 28,194 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 28194:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - orn) + (D-val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg201_1

Search NORINE for peptide: strict or relaxed

AMP-binding (528..927): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2063..2328): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWF-----K
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

ctg201_2

Search NORINE for peptide: strict or relaxed

CAL_domain (51..496): pk

minowa: NH2

Prediction, score:

NH2: 231.8
fatty_acid: 35.1
AHBA: 10.5
Acetyl-CoA: 2.0
shikimic_acid: 0.0

PKS_AT (1269..1592): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.8
inactive: 148.8
Methoxymalonyl-CoA: 56.6
Methylmalonyl-CoA: 49.6
Propionyl-CoA: 41.2
Isobutyryl-CoA: 34.8
Ethylmalonyl-CoA: 25.9
Benzoyl-CoA: 24.3
Acetyl-CoA: 23.6
2-Methylbutyryl-CoA: 19.5
CHC-CoA: 15.1
trans-1,2-CPDA: 12.7
fatty_acid: 8.7
3-Methylbutyryl-CoA: 0.0

AMP-binding (3276..3683): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00204_3300018.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 27,534 nt. (total: 27,534 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27534:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg204_2

Search NORINE for peptide: strict or relaxed

CAL_domain (45..491): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 33.1
NH2: 28.4
AHBA: 22.7
shikimic_acid: 5.7
Acetyl-CoA: 2.0

AMP-binding (1182..1595): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2300..2715): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DSaLiAEVwK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)