3300020146_4 - 17 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00022_3300020.. (original name was: 3300020146.a:Ga0196977_1000051)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	T3PKS	46,546	84,342

c00043_3300020.. (original name was: 3300020146.a:Ga0196977_1000049)

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	NRPS-like	12,571	55,105

c00072_3300020.. (original name was: 3300020146.a:Ga0196977_1000098)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	lassopeptide	13,412	35,525

c00110_3300020.. (original name was: 3300020146.a:Ga0196977_1000330)

Region	Type	From	To	Most similar known cluster		Similarity
Region 110.1	T1PKS	1	26,553

c00194_3300020.. (original name was: 3300020146.a:Ga0196977_1000128)

Region	Type	From	To	Most similar known cluster		Similarity
Region 194.1	NRPS	1	49,257

c00196_3300020.. (original name was: 3300020146.a:Ga0196977_1000125)

Region	Type	From	To	Most similar known cluster		Similarity
Region 196.1	lassopeptide	24,780	47,528

c00198_3300020.. (original name was: 3300020146.a:Ga0196977_1000683)

Region	Type	From	To	Most similar known cluster		Similarity
Region 198.1	microviridin	1	11,525

c00199_3300020.. (original name was: 3300020146.a:Ga0196977_1000302)

Region	Type	From	To	Most similar known cluster		Similarity
Region 199.1	NRPS	1	28,119

c00210_3300020.. (original name was: 3300020146.a:Ga0196977_1000084)

Region	Type	From	To	Most similar known cluster		Similarity
Region 210.1	lanthipeptide	19,826	42,549

c00280_3300020.. (original name was: 3300020146.a:Ga0196977_1000066)

Region	Type	From	To	Most similar known cluster		Similarity
Region 280.1	NRPS,T1PKS	1	45,827

c00302_3300020.. (original name was: 3300020146.a:Ga0196977_1000829)

Region	Type	From	To	Most similar known cluster		Similarity
Region 302.1	NRPS	1	13,871

c00324_3300020.. (original name was: 3300020146.a:Ga0196977_1001774)

Region	Type	From	To	Most similar known cluster		Similarity
Region 324.1	bacteriocin	1	7,545

c00325_3300020.. (original name was: 3300020146.a:Ga0196977_1001795)

Region	Type	From	To	Most similar known cluster		Similarity
Region 325.1	other	1	7,486

c00334_3300020.. (original name was: 3300020146.a:Ga0196977_1000069)

Region	Type	From	To	Most similar known cluster		Similarity
Region 334.1	lanthipeptide	54,270	71,093

c00356_3300020.. (original name was: 3300020146.a:Ga0196977_1006289)

Region	Type	From	To	Most similar known cluster		Similarity
Region 356.1	bacteriocin	1	3,077

c00364_3300020.. (original name was: 3300020146.a:Ga0196977_1000417)

Region	Type	From	To	Most similar known cluster		Similarity
Region 364.1	NRPS-like	1	22,422

c00366_3300020.. (original name was: 3300020146.a:Ga0196977_1000494)

Region	Type	From	To	Most similar known cluster		Similarity
Region 366.1	NRPS	1	20,629

Region	Type	From	To	Similarity
Region 22.1	T3PKS	46,546	84,342
Region 43.1	NRPS-like	12,571	55,105
Region 72.1	lassopeptide	13,412	35,525
Region 110.1	T1PKS	1	26,553
Region 194.1	NRPS	1	49,257
Region 196.1	lassopeptide	24,780	47,528
Region 198.1	microviridin	1	11,525
Region 199.1	NRPS	1	28,119
Region 210.1	lanthipeptide	19,826	42,549
Region 280.1	NRPS,T1PKS	1	45,827
Region 302.1	NRPS	1	13,871
Region 324.1	bacteriocin	1	7,545
Region 325.1	other	1	7,486
Region 334.1	lanthipeptide	54,270	71,093
Region 356.1	bacteriocin	1	3,077
Region 364.1	NRPS-like	1	22,422
Region 366.1	NRPS	1	20,629

No secondary metabolite regions were found in these records:: c00001_3300020.. (original name was: 3300020146.a:Ga0196977_1006578); c00002_3300020.. (original name was: 3300020146.a:Ga0196977_1005276); c00003_3300020.. (original name was: 3300020146.a:Ga0196977_1005213); c00004_3300020.. (original name was: 3300020146.a:Ga0196977_1004842); c00005_3300020.. (original name was: 3300020146.a:Ga0196977_1004058); c00006_3300020.. (original name was: 3300020146.a:Ga0196977_1003792); c00007_3300020.. (original name was: 3300020146.a:Ga0196977_1003722); c00008_3300020.. (original name was: 3300020146.a:Ga0196977_1003701); c00009_3300020.. (original name was: 3300020146.a:Ga0196977_1003645); c00010_3300020.. (original name was: 3300020146.a:Ga0196977_1002630); c00011_3300020.. (original name was: 3300020146.a:Ga0196977_1001556); c00012_3300020.. (original name was: 3300020146.a:Ga0196977_1005170); c00013_3300020.. (original name was: 3300020146.a:Ga0196977_1000637); c00014_3300020.. (original name was: 3300020146.a:Ga0196977_1003255); c00015_3300020.. (original name was: 3300020146.a:Ga0196977_1001094); c00016_3300020.. (original name was: 3300020146.a:Ga0196977_1000856); c00017_3300020.. (original name was: 3300020146.a:Ga0196977_1000310); c00018_3300020.. (original name was: 3300020146.a:Ga0196977_1000240); c00019_3300020.. (original name was: 3300020146.a:Ga0196977_1001577); c00020_3300020.. (original name was: 3300020146.a:Ga0196977_1000100); c00021_3300020.. (original name was: 3300020146.a:Ga0196977_1003998); c00023_3300020.. (original name was: 3300020146.a:Ga0196977_1004984); c00024_3300020.. (original name was: 3300020146.a:Ga0196977_1005727); c00025_3300020.. (original name was: 3300020146.a:Ga0196977_1001185); c00026_3300020.. (original name was: 3300020146.a:Ga0196977_1004803); c00027_3300020.. (original name was: 3300020146.a:Ga0196977_1001140); c00028_3300020.. (original name was: 3300020146.a:Ga0196977_1000324); c00029_3300020.. (original name was: 3300020146.a:Ga0196977_1003942); c00030_3300020.. (original name was: 3300020146.a:Ga0196977_1000837); c00031_3300020.. (original name was: 3300020146.a:Ga0196977_1003564); c00032_3300020.. (original name was: 3300020146.a:Ga0196977_1000108); c00033_3300020.. (original name was: 3300020146.a:Ga0196977_1002143); c00034_3300020.. (original name was: 3300020146.a:Ga0196977_1004782); c00035_3300020.. (original name was: 3300020146.a:Ga0196977_1001996); c00036_3300020.. (original name was: 3300020146.a:Ga0196977_1000961); c00037_3300020.. (original name was: 3300020146.a:Ga0196977_1004617); c00038_3300020.. (original name was: 3300020146.a:Ga0196977_1000479); c00039_3300020.. (original name was: 3300020146.a:Ga0196977_1001954); c00040_3300020.. (original name was: 3300020146.a:Ga0196977_1000926); c00041_3300020.. (original name was: 3300020146.a:Ga0196977_1000691); c00042_3300020.. (original name was: 3300020146.a:Ga0196977_1001877); c00044_3300020.. (original name was: 3300020146.a:Ga0196977_1000907); c00045_3300020.. (original name was: 3300020146.a:Ga0196977_1001142); c00046_3300020.. (original name was: 3300020146.a:Ga0196977_1001009); c00047_3300020.. (original name was: 3300020146.a:Ga0196977_1000771); c00048_3300020.. (original name was: 3300020146.a:Ga0196977_1005697); c00049_3300020.. (original name was: 3300020146.a:Ga0196977_1000687); c00050_3300020.. (original name was: 3300020146.a:Ga0196977_1000631); c00051_3300020.. (original name was: 3300020146.a:Ga0196977_1002224); c00052_3300020.. (original name was: 3300020146.a:Ga0196977_1000547); c00053_3300020.. (original name was: 3300020146.a:Ga0196977_1002375); c00054_3300020.. (original name was: 3300020146.a:Ga0196977_1000470); c00055_3300020.. (original name was: 3300020146.a:Ga0196977_1000449); c00056_3300020.. (original name was: 3300020146.a:Ga0196977_1005905); c00057_3300020.. (original name was: 3300020146.a:Ga0196977_1000523); c00058_3300020.. (original name was: 3300020146.a:Ga0196977_1003021); c00059_3300020.. (original name was: 3300020146.a:Ga0196977_1000316); c00060_3300020.. (original name was: 3300020146.a:Ga0196977_1000288); c00061_3300020.. (original name was: 3300020146.a:Ga0196977_1000225); c00062_3300020.. (original name was: 3300020146.a:Ga0196977_1000211); c00063_3300020.. (original name was: 3300020146.a:Ga0196977_1000043); c00064_3300020.. (original name was: 3300020146.a:Ga0196977_1006237); c00065_3300020.. (original name was: 3300020146.a:Ga0196977_1001069); c00066_3300020.. (original name was: 3300020146.a:Ga0196977_1006006); c00067_3300020.. (original name was: 3300020146.a:Ga0196977_1000483); c00068_3300020.. (original name was: 3300020146.a:Ga0196977_1001266); c00069_3300020.. (original name was: 3300020146.a:Ga0196977_1005936); c00070_3300020.. (original name was: 3300020146.a:Ga0196977_1003866); c00071_3300020.. (original name was: 3300020146.a:Ga0196977_1005824); c00073_3300020.. (original name was: 3300020146.a:Ga0196977_1000882); c00074_3300020.. (original name was: 3300020146.a:Ga0196977_1005331); c00075_3300020.. (original name was: 3300020146.a:Ga0196977_1004019); c00076_3300020.. (original name was: 3300020146.a:Ga0196977_1004970); c00077_3300020.. (original name was: 3300020146.a:Ga0196977_1004728); c00078_3300020.. (original name was: 3300020146.a:Ga0196977_1004606); c00079_3300020.. (original name was: 3300020146.a:Ga0196977_1001501); c00080_3300020.. (original name was: 3300020146.a:Ga0196977_1004046); c00081_3300020.. (original name was: 3300020146.a:Ga0196977_1000148); c00082_3300020.. (original name was: 3300020146.a:Ga0196977_1001183); c00083_3300020.. (original name was: 3300020146.a:Ga0196977_1002092); c00084_3300020.. (original name was: 3300020146.a:Ga0196977_1003913); c00085_3300020.. (original name was: 3300020146.a:Ga0196977_1004143); c00086_3300020.. (original name was: 3300020146.a:Ga0196977_1003908); c00087_3300020.. (original name was: 3300020146.a:Ga0196977_1000627); c00088_3300020.. (original name was: 3300020146.a:Ga0196977_1000616); c00089_3300020.. (original name was: 3300020146.a:Ga0196977_1001174); c00090_3300020.. (original name was: 3300020146.a:Ga0196977_1002636); c00091_3300020.. (original name was: 3300020146.a:Ga0196977_1003436); c00092_3300020.. (original name was: 3300020146.a:Ga0196977_1005790); c00093_3300020.. (original name was: 3300020146.a:Ga0196977_1004755); c00094_3300020.. (original name was: 3300020146.a:Ga0196977_1002685); c00095_3300020.. (original name was: 3300020146.a:Ga0196977_1000720); c00096_3300020.. (original name was: 3300020146.a:Ga0196977_1006211); c00097_3300020.. (original name was: 3300020146.a:Ga0196977_1000250); c00098_3300020.. (original name was: 3300020146.a:Ga0196977_1000150); c00099_3300020.. (original name was: 3300020146.a:Ga0196977_1003093); c00100_3300020.. (original name was: 3300020146.a:Ga0196977_1000120); c00101_3300020.. (original name was: 3300020146.a:Ga0196977_1000788); c00102_3300020.. (original name was: 3300020146.a:Ga0196977_1002282); c00103_3300020.. (original name was: 3300020146.a:Ga0196977_1000407); c00104_3300020.. (original name was: 3300020146.a:Ga0196977_1000055); c00105_3300020.. (original name was: 3300020146.a:Ga0196977_1006221); c00106_3300020.. (original name was: 3300020146.a:Ga0196977_1003403); c00107_3300020.. (original name was: 3300020146.a:Ga0196977_1005546); c00108_3300020.. (original name was: 3300020146.a:Ga0196977_1000772); c00109_3300020.. (original name was: 3300020146.a:Ga0196977_1002600); c00111_3300020.. (original name was: 3300020146.a:Ga0196977_1006242); c00112_3300020.. (original name was: 3300020146.a:Ga0196977_1001281); c00113_3300020.. (original name was: 3300020146.a:Ga0196977_1004144); c00114_3300020.. (original name was: 3300020146.a:Ga0196977_1002848); c00115_3300020.. (original name was: 3300020146.a:Ga0196977_1001492); c00116_3300020.. (original name was: 3300020146.a:Ga0196977_1001250); c00117_3300020.. (original name was: 3300020146.a:Ga0196977_1000735); c00118_3300020.. (original name was: 3300020146.a:Ga0196977_1004416); c00119_3300020.. (original name was: 3300020146.a:Ga0196977_1004811); c00120_3300020.. (original name was: 3300020146.a:Ga0196977_1000525); c00121_3300020.. (original name was: 3300020146.a:Ga0196977_1001083); c00122_3300020.. (original name was: 3300020146.a:Ga0196977_1001927); c00123_3300020.. (original name was: 3300020146.a:Ga0196977_1000140); c00124_3300020.. (original name was: 3300020146.a:Ga0196977_1000698); c00125_3300020.. (original name was: 3300020146.a:Ga0196977_1002268); c00126_3300020.. (original name was: 3300020146.a:Ga0196977_1000346); c00127_3300020.. (original name was: 3300020146.a:Ga0196977_1003289); c00128_3300020.. (original name was: 3300020146.a:Ga0196977_1000287); c00129_3300020.. (original name was: 3300020146.a:Ga0196977_1000636); c00130_3300020.. (original name was: 3300020146.a:Ga0196977_1001339); c00131_3300020.. (original name was: 3300020146.a:Ga0196977_1000455); c00132_3300020.. (original name was: 3300020146.a:Ga0196977_1000552); c00133_3300020.. (original name was: 3300020146.a:Ga0196977_1000930); c00134_3300020.. (original name was: 3300020146.a:Ga0196977_1000695); c00135_3300020.. (original name was: 3300020146.a:Ga0196977_1001479); c00136_3300020.. (original name was: 3300020146.a:Ga0196977_1000444); c00137_3300020.. (original name was: 3300020146.a:Ga0196977_1002272); c00138_3300020.. (original name was: 3300020146.a:Ga0196977_1004325); c00139_3300020.. (original name was: 3300020146.a:Ga0196977_1002715); c00140_3300020.. (original name was: 3300020146.a:Ga0196977_1003273); c00141_3300020.. (original name was: 3300020146.a:Ga0196977_1003078); c00142_3300020.. (original name was: 3300020146.a:Ga0196977_1001728); c00143_3300020.. (original name was: 3300020146.a:Ga0196977_1001861); c00144_3300020.. (original name was: 3300020146.a:Ga0196977_1003254); c00145_3300020.. (original name was: 3300020146.a:Ga0196977_1000391); c00146_3300020.. (original name was: 3300020146.a:Ga0196977_1001984); c00147_3300020.. (original name was: 3300020146.a:Ga0196977_1000917); c00148_3300020.. (original name was: 3300020146.a:Ga0196977_1000675); c00149_3300020.. (original name was: 3300020146.a:Ga0196977_1004027); c00150_3300020.. (original name was: 3300020146.a:Ga0196977_1000083); c00151_3300020.. (original name was: 3300020146.a:Ga0196977_1000641); c00152_3300020.. (original name was: 3300020146.a:Ga0196977_1006194); c00153_3300020.. (original name was: 3300020146.a:Ga0196977_1000566); c00154_3300020.. (original name was: 3300020146.a:Ga0196977_1001195); c00155_3300020.. (original name was: 3300020146.a:Ga0196977_1000520); c00156_3300020.. (original name was: 3300020146.a:Ga0196977_1003867); c00157_3300020.. (original name was: 3300020146.a:Ga0196977_1001724); c00158_3300020.. (original name was: 3300020146.a:Ga0196977_1001489); c00159_3300020.. (original name was: 3300020146.a:Ga0196977_1001282); c00160_3300020.. (original name was: 3300020146.a:Ga0196977_1003903); c00161_3300020.. (original name was: 3300020146.a:Ga0196977_1001822); c00162_3300020.. (original name was: 3300020146.a:Ga0196977_1000938); c00163_3300020.. (original name was: 3300020146.a:Ga0196977_1002524); c00164_3300020.. (original name was: 3300020146.a:Ga0196977_1000415); c00165_3300020.. (original name was: 3300020146.a:Ga0196977_1006376); c00166_3300020.. (original name was: 3300020146.a:Ga0196977_1001793); c00167_3300020.. (original name was: 3300020146.a:Ga0196977_1003261); c00168_3300020.. (original name was: 3300020146.a:Ga0196977_1000685); c00169_3300020.. (original name was: 3300020146.a:Ga0196977_1000706); c00170_3300020.. (original name was: 3300020146.a:Ga0196977_1000918); c00171_3300020.. (original name was: 3300020146.a:Ga0196977_1002813); c00172_3300020.. (original name was: 3300020146.a:Ga0196977_1000674); c00173_3300020.. (original name was: 3300020146.a:Ga0196977_1001467); c00174_3300020.. (original name was: 3300020146.a:Ga0196977_1000439); c00175_3300020.. (original name was: 3300020146.a:Ga0196977_1004913); c00176_3300020.. (original name was: 3300020146.a:Ga0196977_1004677); c00177_3300020.. (original name was: 3300020146.a:Ga0196977_1000056); c00178_3300020.. (original name was: 3300020146.a:Ga0196977_1004505); c00179_3300020.. (original name was: 3300020146.a:Ga0196977_1001987); c00180_3300020.. (original name was: 3300020146.a:Ga0196977_1000359); c00181_3300020.. (original name was: 3300020146.a:Ga0196977_1000868); c00182_3300020.. (original name was: 3300020146.a:Ga0196977_1000768); c00183_3300020.. (original name was: 3300020146.a:Ga0196977_1000093); c00184_3300020.. (original name was: 3300020146.a:Ga0196977_1005819); c00185_3300020.. (original name was: 3300020146.a:Ga0196977_1000153); c00186_3300020.. (original name was: 3300020146.a:Ga0196977_1002031); c00187_3300020.. (original name was: 3300020146.a:Ga0196977_1000761); c00188_3300020.. (original name was: 3300020146.a:Ga0196977_1001630); c00189_3300020.. (original name was: 3300020146.a:Ga0196977_1000162); c00190_3300020.. (original name was: 3300020146.a:Ga0196977_1001197); c00191_3300020.. (original name was: 3300020146.a:Ga0196977_1006401); c00192_3300020.. (original name was: 3300020146.a:Ga0196977_1002783); c00193_3300020.. (original name was: 3300020146.a:Ga0196977_1004843); c00195_3300020.. (original name was: 3300020146.a:Ga0196977_1002472); c00197_3300020.. (original name was: 3300020146.a:Ga0196977_1005776); c00200_3300020.. (original name was: 3300020146.a:Ga0196977_1001895); c00201_3300020.. (original name was: 3300020146.a:Ga0196977_1000580); c00202_3300020.. (original name was: 3300020146.a:Ga0196977_1006341); c00203_3300020.. (original name was: 3300020146.a:Ga0196977_1001173); c00204_3300020.. (original name was: 3300020146.a:Ga0196977_1000505); c00205_3300020.. (original name was: 3300020146.a:Ga0196977_1001540); c00206_3300020.. (original name was: 3300020146.a:Ga0196977_1000263); c00207_3300020.. (original name was: 3300020146.a:Ga0196977_1000491); c00208_3300020.. (original name was: 3300020146.a:Ga0196977_1000728); c00209_3300020.. (original name was: 3300020146.a:Ga0196977_1004705); c00211_3300020.. (original name was: 3300020146.a:Ga0196977_1002470); c00212_3300020.. (original name was: 3300020146.a:Ga0196977_1001670); c00213_3300020.. (original name was: 3300020146.a:Ga0196977_1000642); c00214_3300020.. (original name was: 3300020146.a:Ga0196977_1005449); c00215_3300020.. (original name was: 3300020146.a:Ga0196977_1002631); c00216_3300020.. (original name was: 3300020146.a:Ga0196977_1003189); c00217_3300020.. (original name was: 3300020146.a:Ga0196977_1000294); c00218_3300020.. (original name was: 3300020146.a:Ga0196977_1000967); c00219_3300020.. (original name was: 3300020146.a:Ga0196977_1002795); c00220_3300020.. (original name was: 3300020146.a:Ga0196977_1000777); c00221_3300020.. (original name was: 3300020146.a:Ga0196977_1003588); c00222_3300020.. (original name was: 3300020146.a:Ga0196977_1000076); c00223_3300020.. (original name was: 3300020146.a:Ga0196977_1001669); c00224_3300020.. (original name was: 3300020146.a:Ga0196977_1004262); c00225_3300020.. (original name was: 3300020146.a:Ga0196977_1000651); c00226_3300020.. (original name was: 3300020146.a:Ga0196977_1003272); c00227_3300020.. (original name was: 3300020146.a:Ga0196977_1001209); c00228_3300020.. (original name was: 3300020146.a:Ga0196977_1005390); c00229_3300020.. (original name was: 3300020146.a:Ga0196977_1001772); c00230_3300020.. (original name was: 3300020146.a:Ga0196977_1004941); c00231_3300020.. (original name was: 3300020146.a:Ga0196977_1001330); c00232_3300020.. (original name was: 3300020146.a:Ga0196977_1003079); c00233_3300020.. (original name was: 3300020146.a:Ga0196977_1002844); c00234_3300020.. (original name was: 3300020146.a:Ga0196977_1002443); c00235_3300020.. (original name was: 3300020146.a:Ga0196977_1000293); c00236_3300020.. (original name was: 3300020146.a:Ga0196977_1000742); c00237_3300020.. (original name was: 3300020146.a:Ga0196977_1000435); c00238_3300020.. (original name was: 3300020146.a:Ga0196977_1000629); c00239_3300020.. (original name was: 3300020146.a:Ga0196977_1002779); c00240_3300020.. (original name was: 3300020146.a:Ga0196977_1000474); c00241_3300020.. (original name was: 3300020146.a:Ga0196977_1000847); c00242_3300020.. (original name was: 3300020146.a:Ga0196977_1002240); c00243_3300020.. (original name was: 3300020146.a:Ga0196977_1003600); c00244_3300020.. (original name was: 3300020146.a:Ga0196977_1005075); c00245_3300020.. (original name was: 3300020146.a:Ga0196977_1000896); c00246_3300020.. (original name was: 3300020146.a:Ga0196977_1002831); c00247_3300020.. (original name was: 3300020146.a:Ga0196977_1000688); c00248_3300020.. (original name was: 3300020146.a:Ga0196977_1001481); c00249_3300020.. (original name was: 3300020146.a:Ga0196977_1000453); c00250_3300020.. (original name was: 3300020146.a:Ga0196977_1001463); c00251_3300020.. (original name was: 3300020146.a:Ga0196977_1001221); c00252_3300020.. (original name was: 3300020146.a:Ga0196977_1001680); c00253_3300020.. (original name was: 3300020146.a:Ga0196977_1000446); c00254_3300020.. (original name was: 3300020146.a:Ga0196977_1002863); c00255_3300020.. (original name was: 3300020146.a:Ga0196977_1003656); c00256_3300020.. (original name was: 3300020146.a:Ga0196977_1002011); c00257_3300020.. (original name was: 3300020146.a:Ga0196977_1002886); c00258_3300020.. (original name was: 3300020146.a:Ga0196977_1003159); c00259_3300020.. (original name was: 3300020146.a:Ga0196977_1000421); c00260_3300020.. (original name was: 3300020146.a:Ga0196977_1001089); c00261_3300020.. (original name was: 3300020146.a:Ga0196977_1003432); c00262_3300020.. (original name was: 3300020146.a:Ga0196977_1005025); c00263_3300020.. (original name was: 3300020146.a:Ga0196977_1004225); c00264_3300020.. (original name was: 3300020146.a:Ga0196977_1003887); c00265_3300020.. (original name was: 3300020146.a:Ga0196977_1001149); c00266_3300020.. (original name was: 3300020146.a:Ga0196977_1001817); c00267_3300020.. (original name was: 3300020146.a:Ga0196977_1004265); c00268_3300020.. (original name was: 3300020146.a:Ga0196977_1000126); c00269_3300020.. (original name was: 3300020146.a:Ga0196977_1004412); c00270_3300020.. (original name was: 3300020146.a:Ga0196977_1004545); c00271_3300020.. (original name was: 3300020146.a:Ga0196977_1002416); c00272_3300020.. (original name was: 3300020146.a:Ga0196977_1004559); c00273_3300020.. (original name was: 3300020146.a:Ga0196977_1000980); c00274_3300020.. (original name was: 3300020146.a:Ga0196977_1005266); c00275_3300020.. (original name was: 3300020146.a:Ga0196977_1004231); c00276_3300020.. (original name was: 3300020146.a:Ga0196977_1004605); c00277_3300020.. (original name was: 3300020146.a:Ga0196977_1005280); c00278_3300020.. (original name was: 3300020146.a:Ga0196977_1004685); c00279_3300020.. (original name was: 3300020146.a:Ga0196977_1003210); c00281_3300020.. (original name was: 3300020146.a:Ga0196977_1000087); c00282_3300020.. (original name was: 3300020146.a:Ga0196977_1000227); c00283_3300020.. (original name was: 3300020146.a:Ga0196977_1001027); c00284_3300020.. (original name was: 3300020146.a:Ga0196977_1000234); c00285_3300020.. (original name was: 3300020146.a:Ga0196977_1000423); c00286_3300020.. (original name was: 3300020146.a:Ga0196977_1000548); c00287_3300020.. (original name was: 3300020146.a:Ga0196977_1001223); c00288_3300020.. (original name was: 3300020146.a:Ga0196977_1000437); c00289_3300020.. (original name was: 3300020146.a:Ga0196977_1002265); c00290_3300020.. (original name was: 3300020146.a:Ga0196977_1000465); c00291_3300020.. (original name was: 3300020146.a:Ga0196977_1000577); c00292_3300020.. (original name was: 3300020146.a:Ga0196977_1000584); c00293_3300020.. (original name was: 3300020146.a:Ga0196977_1000598); c00294_3300020.. (original name was: 3300020146.a:Ga0196977_1005289); c00295_3300020.. (original name was: 3300020146.a:Ga0196977_1000619); c00296_3300020.. (original name was: 3300020146.a:Ga0196977_1002447); c00297_3300020.. (original name was: 3300020146.a:Ga0196977_1002178); c00298_3300020.. (original name was: 3300020146.a:Ga0196977_1000703); c00299_3300020.. (original name was: 3300020146.a:Ga0196977_1004006); c00300_3300020.. (original name was: 3300020146.a:Ga0196977_1002531); c00301_3300020.. (original name was: 3300020146.a:Ga0196977_1000759); c00303_3300020.. (original name was: 3300020146.a:Ga0196977_1005964); c00304_3300020.. (original name was: 3300020146.a:Ga0196977_1000871); c00305_3300020.. (original name was: 3300020146.a:Ga0196977_1001671); c00306_3300020.. (original name was: 3300020146.a:Ga0196977_1000899); c00307_3300020.. (original name was: 3300020146.a:Ga0196977_1005283); c00308_3300020.. (original name was: 3300020146.a:Ga0196977_1000990); c00309_3300020.. (original name was: 3300020146.a:Ga0196977_1001790); c00310_3300020.. (original name was: 3300020146.a:Ga0196977_1001312); c00311_3300020.. (original name was: 3300020146.a:Ga0196977_1001752); c00312_3300020.. (original name was: 3300020146.a:Ga0196977_1000277); c00313_3300020.. (original name was: 3300020146.a:Ga0196977_1005724); c00314_3300020.. (original name was: 3300020146.a:Ga0196977_1001431); c00315_3300020.. (original name was: 3300020146.a:Ga0196977_1000798); c00316_3300020.. (original name was: 3300020146.a:Ga0196977_1001466); c00317_3300020.. (original name was: 3300020146.a:Ga0196977_1000431); c00318_3300020.. (original name was: 3300020146.a:Ga0196977_1001627); c00319_3300020.. (original name was: 3300020146.a:Ga0196977_1000166); c00320_3300020.. (original name was: 3300020146.a:Ga0196977_1001634); c00321_3300020.. (original name was: 3300020146.a:Ga0196977_1006325); c00322_3300020.. (original name was: 3300020146.a:Ga0196977_1001697); c00323_3300020.. (original name was: 3300020146.a:Ga0196977_1000662); c00326_3300020.. (original name was: 3300020146.a:Ga0196977_1000760); c00327_3300020.. (original name was: 3300020146.a:Ga0196977_1003987); c00328_3300020.. (original name was: 3300020146.a:Ga0196977_1001844); c00329_3300020.. (original name was: 3300020146.a:Ga0196977_1002656); c00330_3300020.. (original name was: 3300020146.a:Ga0196977_1003096); c00331_3300020.. (original name was: 3300020146.a:Ga0196977_1001621); c00332_3300020.. (original name was: 3300020146.a:Ga0196977_1001258); c00333_3300020.. (original name was: 3300020146.a:Ga0196977_1002726); c00335_3300020.. (original name was: 3300020146.a:Ga0196977_1002887); c00336_3300020.. (original name was: 3300020146.a:Ga0196977_1003783); c00337_3300020.. (original name was: 3300020146.a:Ga0196977_1003825); c00338_3300020.. (original name was: 3300020146.a:Ga0196977_1004007); c00339_3300020.. (original name was: 3300020146.a:Ga0196977_1004266); c00340_3300020.. (original name was: 3300020146.a:Ga0196977_1005846); c00341_3300020.. (original name was: 3300020146.a:Ga0196977_1004371); c00342_3300020.. (original name was: 3300020146.a:Ga0196977_1000977); c00343_3300020.. (original name was: 3300020146.a:Ga0196977_1003927); c00344_3300020.. (original name was: 3300020146.a:Ga0196977_1004595); c00345_3300020.. (original name was: 3300020146.a:Ga0196977_1005043); c00346_3300020.. (original name was: 3300020146.a:Ga0196977_1000932); c00347_3300020.. (original name was: 3300020146.a:Ga0196977_1005218); c00348_3300020.. (original name was: 3300020146.a:Ga0196977_1005337); c00349_3300020.. (original name was: 3300020146.a:Ga0196977_1003876); c00350_3300020.. (original name was: 3300020146.a:Ga0196977_1005344); c00351_3300020.. (original name was: 3300020146.a:Ga0196977_1005358); c00352_3300020.. (original name was: 3300020146.a:Ga0196977_1004323); c00353_3300020.. (original name was: 3300020146.a:Ga0196977_1005554); c00354_3300020.. (original name was: 3300020146.a:Ga0196977_1005806); c00355_3300020.. (original name was: 3300020146.a:Ga0196977_1004771); c00357_3300020.. (original name was: 3300020146.a:Ga0196977_1000242); c00358_3300020.. (original name was: 3300020146.a:Ga0196977_1001829); c00359_3300020.. (original name was: 3300020146.a:Ga0196977_1000354); c00360_3300020.. (original name was: 3300020146.a:Ga0196977_1001514); c00361_3300020.. (original name was: 3300020146.a:Ga0196977_1000839); c00362_3300020.. (original name was: 3300020146.a:Ga0196977_1002189); c00363_3300020.. (original name was: 3300020146.a:Ga0196977_1000361); c00365_3300020.. (original name was: 3300020146.a:Ga0196977_1000438); c00367_3300020.. (original name was: 3300020146.a:Ga0196977_1001315); c00368_3300020.. (original name was: 3300020146.a:Ga0196977_1000515); c00369_3300020.. (original name was: 3300020146.a:Ga0196977_1002256); c00370_3300020.. (original name was: 3300020146.a:Ga0196977_1000781); c00371_3300020.. (original name was: 3300020146.a:Ga0196977_1002945); c00372_3300020.. (original name was: 3300020146.a:Ga0196977_1000795); c00373_3300020.. (original name was: 3300020146.a:Ga0196977_1000400); c00374_3300020.. (original name was: 3300020146.a:Ga0196977_1001068); c00375_3300020.. (original name was: 3300020146.a:Ga0196977_1004840); c00376_3300020.. (original name was: 3300020146.a:Ga0196977_1001222); c00377_3300020.. (original name was: 3300020146.a:Ga0196977_1001327); c00378_3300020.. (original name was: 3300020146.a:Ga0196977_1001348); c00379_3300020.. (original name was: 3300020146.a:Ga0196977_1000320); c00380_3300020.. (original name was: 3300020146.a:Ga0196977_1001432); c00381_3300020.. (original name was: 3300020146.a:Ga0196977_1001964); c00382_3300020.. (original name was: 3300020146.a:Ga0196977_1003203); c00383_3300020.. (original name was: 3300020146.a:Ga0196977_1002175); c00384_3300020.. (original name was: 3300020146.a:Ga0196977_1003413); c00385_3300020.. (original name was: 3300020146.a:Ga0196977_1003420); c00386_3300020.. (original name was: 3300020146.a:Ga0196977_1003665); c00387_3300020.. (original name was: 3300020146.a:Ga0196977_1004675); c00388_3300020.. (original name was: 3300020146.a:Ga0196977_1003875); c00389_3300020.. (original name was: 3300020146.a:Ga0196977_1001456); c00390_3300020.. (original name was: 3300020146.a:Ga0196977_1004267); c00391_3300020.. (original name was: 3300020146.a:Ga0196977_1002313); c00392_3300020.. (original name was: 3300020146.a:Ga0196977_1004456); c00393_3300020.. (original name was: 3300020146.a:Ga0196977_1000184); c00394_3300020.. (original name was: 3300020146.a:Ga0196977_1004470); c00395_3300020.. (original name was: 3300020146.a:Ga0196977_1005618); c00396_3300020.. (original name was: 3300020146.a:Ga0196977_1001675); c00397_3300020.. (original name was: 3300020146.a:Ga0196977_1001000); c00398_3300020.. (original name was: 3300020146.a:Ga0196977_1002350); c00399_3300020.. (original name was: 3300020146.a:Ga0196977_1005961); c00400_3300020.. (original name was: 3300020146.a:Ga0196977_1000131); c00401_3300020.. (original name was: 3300020146.a:Ga0196977_1001676); c00402_3300020.. (original name was: 3300020146.a:Ga0196977_1000208); c00403_3300020.. (original name was: 3300020146.a:Ga0196977_1001043); c00404_3300020.. (original name was: 3300020146.a:Ga0196977_1000243); c00405_3300020.. (original name was: 3300020146.a:Ga0196977_1000467); c00406_3300020.. (original name was: 3300020146.a:Ga0196977_1001977); c00407_3300020.. (original name was: 3300020146.a:Ga0196977_1000509); c00408_3300020.. (original name was: 3300020146.a:Ga0196977_1000551); c00409_3300020.. (original name was: 3300020146.a:Ga0196977_1000677); c00410_3300020.. (original name was: 3300020146.a:Ga0196977_1000971); c00411_3300020.. (original name was: 3300020146.a:Ga0196977_1001664); c00412_3300020.. (original name was: 3300020146.a:Ga0196977_1000503); c00413_3300020.. (original name was: 3300020146.a:Ga0196977_1001853); c00414_3300020.. (original name was: 3300020146.a:Ga0196977_1001276); c00415_3300020.. (original name was: 3300020146.a:Ga0196977_1002751); c00416_3300020.. (original name was: 3300020146.a:Ga0196977_1001951); c00417_3300020.. (original name was: 3300020146.a:Ga0196977_1001430); c00418_3300020.. (original name was: 3300020146.a:Ga0196977_1000755); c00419_3300020.. (original name was: 3300020146.a:Ga0196977_1003573); c00420_3300020.. (original name was: 3300020146.a:Ga0196977_1002105); c00421_3300020.. (original name was: 3300020146.a:Ga0196977_1002217); c00422_3300020.. (original name was: 3300020146.a:Ga0196977_1001584); c00423_3300020.. (original name was: 3300020146.a:Ga0196977_1000109); c00424_3300020.. (original name was: 3300020146.a:Ga0196977_1002259); c00425_3300020.. (original name was: 3300020146.a:Ga0196977_1002322)

Compact view

c00022_3300020.. - Region 1 - T3PKS

Download region GenBank file

Location: 46,546 - 84,342 nt. (total: 37,797 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00043_3300020.. - Region 1 - NRPS-like

Download region GenBank file

Location: 12,571 - 55,105 nt. (total: 42,535 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 12570 - 55105:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg43_22

Search NORINE for peptide: strict or relaxed

AMP-binding (15..419): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vFmvvGgAlK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 40% (weak)

c00072_3300020.. - Region 1 - lassopeptide

Download region GenBank file

Location: 13,412 - 35,525 nt. (total: 22,114 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

c00110_3300020.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 26,553 nt. (total: 26,553 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26553:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg110_9

PKS_AT (623..853): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 78.6
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 48.2
inactive: 44.9
Isobutyryl-CoA: 19.8
Propionyl-CoA: 19.6
CHC-CoA: 17.3
Ethylmalonyl-CoA: 15.1
Benzoyl-CoA: 14.3
fatty_acid: 13.1
trans-1,2-CPDA: 11.2
Acetyl-CoA: 8.0
2-Methylbutyryl-CoA: 5.6
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Propionyl-CoA: 58.3%; inactive: 58.3%

c00194_3300020.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 49,257 nt. (total: 49,257 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 49257:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (X - asn) + (pro - val - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg194_1

Search NORINE for peptide: strict or relaxed

AMP-binding (8..422): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DfkcLSLviK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 50% (weak)

ctg194_7

Search NORINE for peptide: strict or relaxed

AMP-binding (11..417): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgKhvaVVlK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

ctg194_8

Search NORINE for peptide: strict or relaxed

AMP-binding (9..419): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGkhvtILSK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

ctg194_10

Search NORINE for peptide: strict or relaxed

AMP-binding (10..419): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DGkhvAiVAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 60% (weak)

AMP-binding (1080..1461): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg194_20

Search NORINE for peptide: strict or relaxed

AMP-binding (473..875): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQdvAHVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (1537..1918): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2581..2980): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DsKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (3640..4021): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGCVmK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

c00196_3300020.. - Region 1 - lassopeptide

Download region GenBank file

Location: 24,780 - 47,528 nt. (total: 22,749 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

c00198_3300020.. - Region 1 - microviridin

Download region GenBank file

Location: 1 - 11,525 nt. (total: 11,525 nt) Show pHMM detection rules used

Region on contig edge.

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00199_3300020.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 28,119 nt. (total: 28,119 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 28119:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg199_16

Search NORINE for peptide: strict or relaxed

AMP-binding (0..330): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg199_17

Search NORINE for peptide: strict or relaxed

AMP-binding (833..1242): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00210_3300020.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 19,826 - 42,549 nt. (total: 22,724 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg210_21 - Putative Class III

ctg210_20 leader / core peptide: MAMEIVLDLQKLEVPREEELFGDSS - GDhaDhaALACCNDNNG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg210_20 - Class III: Cleavage pHMM score: 10.90; RODEO score: 0; Monoisotopic mass: 1188.4 Da; Molecular weight: 1189.2 Da; Number of bridges: 2

c00280_3300020.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 45,827 nt. (total: 45,827 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 45827:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - leu) + (glu) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg280_6

PKS_AT (536..835): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 157.3
inactive: 109.4
Methoxymalonyl-CoA: 71.8
Methylmalonyl-CoA: 60.6
Ethylmalonyl-CoA: 44.8
Propionyl-CoA: 43.6
Isobutyryl-CoA: 32.2
2-Methylbutyryl-CoA: 31.9
CHC-CoA: 28.5
trans-1,2-CPDA: 24.7
Benzoyl-CoA: 18.8
Acetyl-CoA: 11.8
fatty_acid: 8.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Propionyl-CoA: 54.2%

ctg280_7

Search NORINE for peptide: strict or relaxed

AMP-binding (379..759): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

ctg280_8

Search NORINE for peptide: strict or relaxed

CAL_domain (177..503): pk

minowa: NH2

Prediction, score:

NH2: 169.3
Acetyl-CoA: 49.1
AHBA: 14.8
fatty_acid: 6.6
shikimic_acid: 0.0

AMP-binding (1194..1583): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (2243..2626): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00302_3300020.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,871 nt. (total: 13,871 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13871:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg302_1

Search NORINE for peptide: strict or relaxed

CAL_domain (55..499): pk

minowa: NH2

Prediction, score:

NH2: 214.0
fatty_acid: 30.1
AHBA: 11.9
shikimic_acid: 1.3
Acetyl-CoA: -1.2

AMP-binding (1191..1584): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg302_3

Search NORINE for peptide: strict or relaxed

AMP-binding (247..653): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiRnfGVdvK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

c00324_3300020.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 7,545 nt. (total: 7,545 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00325_3300020.. - Region 1 - other

Download region GenBank file

Location: 1 - 7,486 nt. (total: 7,486 nt) Show pHMM detection rules used

Region on contig edge.

other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00334_3300020.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 54,270 - 71,093 nt. (total: 16,824 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg334_59 - Putative Class II

allorf_63197_63274 leader / core peptide: MLRDGIFVCEIAHRRCSLKGS - FCKDhb
allorf_63638_63829 leader / core peptide: MECRPSDTCCFRTSRRIQARTLQTA - GPPRVRQQDhaDhbPDhaCLGKDhaQIGKPDhaDhaLHWDhbDhbMDhaRGQKANA
allorf_64084_64266 leader / core peptide: MNDRLDGAELVAQWRNHGEEDNPAGPLFAAGEFAEADIVNAT - PGIDhbCGDhbYCDhbGDhaVRVQCC
allorf_62844_63041 leader / core peptide: LNKLSKAMRDSPRRVFLNSTTQDRTPCDDLSRPVAALILDRVSGT - LRDhaAYLMDhaLIARMCDhaCDhaLYV
allorf_63737_63895 leader / core peptide: LRLALISYS - DhaKRVDhbNGRKAFGRDhaRVCLLADhbDhbHDhaRPMKRRWLPDLGLDhaQDhbGRC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_63197_63274 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 479.2 Da

Molecular weight: 479.6 Da

Number of bridges: 1

allorf_63638_63829 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 3914.1 Da

Molecular weight: 3916.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3934.4 Da N = 1; 3952.5 Da N = 2; 3970.5 Da N = 3; 3988.5 Da N = 4; 4006.5 Da N = 5; 4024.5 Da N = 6; 4042.6 Da N = 7; 4060.6 Da N = 8

allorf_64084_64266 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 1774.8 Da

Molecular weight: 1776.1 Da

Number of bridges: 4

allorf_62844_63041 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 2207.1 Da

Molecular weight: 2208.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2226.7 Da N = 1; 2244.8 Da N = 2

allorf_63737_63895 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 4751.6 Da

Molecular weight: 4754.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4772.6 Da N = 1; 4790.6 Da N = 2; 4808.6 Da N = 3; 4826.6 Da N = 4; 4844.6 Da N = 5; 4862.7 Da N = 6

c00356_3300020.. - Region 1 - bacteriocin

Download region GenBank file

Location: 1 - 3,077 nt. (total: 3,077 nt) Show pHMM detection rules used

Region on contig edge.

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00364_3300020.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 22,422 nt. (total: 22,422 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 22422:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg364_19

Search NORINE for peptide: strict or relaxed

AMP-binding (562..998): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eFtviGGpVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

c00366_3300020.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 20,629 nt. (total: 20,629 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 20629:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-ser - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg366_13

Search NORINE for peptide: strict or relaxed

AMP-binding (281..679): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1820..2220): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)