3300025231_6 - 17 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00006_3300025.. (original name was: 3300025231.a:Ga0207427_100037)

Region	Type	From	To
Region 6.1	terpene	165,531	183,221
Region 6.2	bacteriocin	204,279	215,136
Region 6.3	terpene	249,106	272,260

c00007_3300025.. (original name was: 3300025231.a:Ga0207427_100522)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	1	19,997

c00009_3300025.. (original name was: 3300025231.a:Ga0207427_100228)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	indole	4,270	26,249

c00011_3300025.. (original name was: 3300025231.a:Ga0207427_100055)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	NRPS	1	37,734
Region 11.2	arylpolyene	159,162	206,471

c00015_3300025.. (original name was: 3300025231.a:Ga0207427_100051)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS,arylpolyene	85,346	172,115

c00018_3300025.. (original name was: 3300025231.a:Ga0207427_100031)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	terpene	224,481	245,506

c00019_3300025.. (original name was: 3300025231.a:Ga0207427_100075)

Region	Type	From	To	Most similar known cluster		Similarity
Region 19.1	NRPS	1	24,619

c00023_3300025.. (original name was: 3300025231.a:Ga0207427_100153)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS	1	30,776

c00027_3300025.. (original name was: 3300025231.a:Ga0207427_101475)

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	NRPS	1	8,463

c00030_3300025.. (original name was: 3300025231.a:Ga0207427_100095)

Region	Type	From	To	Most similar known cluster		Similarity
Region 30.1	lanthipeptide	36,862	59,699

c00032_3300025.. (original name was: 3300025231.a:Ga0207427_100203)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS,T1PKS	1	48,784

c00033_3300025.. (original name was: 3300025231.a:Ga0207427_100062)

Region	Type	From	To	Most similar known cluster		Similarity
Region 33.1	bacteriocin,lanthipeptide	116,662	148,866

c00040_3300025.. (original name was: 3300025231.a:Ga0207427_101807)

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	NRPS	1	6,859

c00041_3300025.. (original name was: 3300025231.a:Ga0207427_100162)

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	lanthipeptide	47,299	70,031

Region	Type	From	To	Similarity
Region 6.1	terpene	165,531	183,221
Region 6.2	bacteriocin	204,279	215,136
Region 6.3	terpene	249,106	272,260
Region 7.1	NRPS	1	19,997
Region 9.1	indole	4,270	26,249
Region 11.1	NRPS	1	37,734
Region 11.2	arylpolyene	159,162	206,471
Region 15.1	NRPS,arylpolyene	85,346	172,115
Region 18.1	terpene	224,481	245,506
Region 19.1	NRPS	1	24,619
Region 23.1	NRPS	1	30,776
Region 27.1	NRPS	1	8,463
Region 30.1	lanthipeptide	36,862	59,699
Region 32.1	NRPS,T1PKS	1	48,784
Region 33.1	bacteriocin,lanthipeptide	116,662	148,866
Region 40.1	NRPS	1	6,859
Region 41.1	lanthipeptide	47,299	70,031

No secondary metabolite regions were found in these records:: c00001_3300025.. (original name was: 3300025231.a:Ga0207427_100058); c00002_3300025.. (original name was: 3300025231.a:Ga0207427_100252); c00003_3300025.. (original name was: 3300025231.a:Ga0207427_100155); c00004_3300025.. (original name was: 3300025231.a:Ga0207427_101318); c00005_3300025.. (original name was: 3300025231.a:Ga0207427_100033); c00008_3300025.. (original name was: 3300025231.a:Ga0207427_100040); c00010_3300025.. (original name was: 3300025231.a:Ga0207427_100053); c00012_3300025.. (original name was: 3300025231.a:Ga0207427_100057); c00013_3300025.. (original name was: 3300025231.a:Ga0207427_100480); c00014_3300025.. (original name was: 3300025231.a:Ga0207427_100286); c00016_3300025.. (original name was: 3300025231.a:Ga0207427_100145); c00017_3300025.. (original name was: 3300025231.a:Ga0207427_100168); c00020_3300025.. (original name was: 3300025231.a:Ga0207427_100213); c00021_3300025.. (original name was: 3300025231.a:Ga0207427_100336); c00022_3300025.. (original name was: 3300025231.a:Ga0207427_100247); c00024_3300025.. (original name was: 3300025231.a:Ga0207427_100175); c00025_3300025.. (original name was: 3300025231.a:Ga0207427_100081); c00026_3300025.. (original name was: 3300025231.a:Ga0207427_103469); c00028_3300025.. (original name was: 3300025231.a:Ga0207427_100036); c00029_3300025.. (original name was: 3300025231.a:Ga0207427_101728); c00031_3300025.. (original name was: 3300025231.a:Ga0207427_100358); c00034_3300025.. (original name was: 3300025231.a:Ga0207427_100207); c00035_3300025.. (original name was: 3300025231.a:Ga0207427_100160); c00036_3300025.. (original name was: 3300025231.a:Ga0207427_100185); c00037_3300025.. (original name was: 3300025231.a:Ga0207427_100327); c00038_3300025.. (original name was: 3300025231.a:Ga0207427_100045); c00039_3300025.. (original name was: 3300025231.a:Ga0207427_100139); c00042_3300025.. (original name was: 3300025231.a:Ga0207427_100021); c00043_3300025.. (original name was: 3300025231.a:Ga0207427_100261)

Compact view

c00006_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 165,531 - 183,221 nt. (total: 17,691 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00006_3300025.. - Region 2 - bacteriocin

Download region GenBank file

Location: 204,279 - 215,136 nt. (total: 10,858 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00006_3300025.. - Region 3 - terpene

Download region GenBank file

Location: 249,106 - 272,260 nt. (total: 23,155 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00007_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 19,997 nt. (total: 19,997 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 19997:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (tyr - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_4

Search NORINE for peptide: strict or relaxed

AMP-binding (464..866): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALtVGhVlK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

AMP-binding (1530..1941): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: gAfFFGLVlK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg7_6

Search NORINE for peptide: strict or relaxed

CAL_domain (45..492): pk

minowa: NH2

Prediction, score:

NH2: 113.8
AHBA: 7.7
shikimic_acid: 0.0
fatty_acid: 0.0
Acetyl-CoA: -3.9

AMP-binding (1159..1557): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

c00009_3300025.. - Region 1 - indole

Download region GenBank file

Location: 4,270 - 26,249 nt. (total: 21,980 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00011_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 37,734 nt. (total: 37,734 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 37734:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg11_18

Search NORINE for peptide: strict or relaxed

AMP-binding (465..855): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DILwLGLVlK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

c00011_3300025.. - Region 2 - arylpolyene

Download region GenBank file

Location: 159,162 - 206,471 nt. (total: 47,310 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00015_3300025.. - Region 1 - NRPS,arylpolyene

Download region GenBank file

Location: 85,346 - 172,115 nt. (total: 86,770 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 85345 - 172115:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 85345 - 147886:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_87

Search NORINE for peptide: strict or relaxed

AMP-binding (24..302): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gvMV-----K
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 30% (weak)

ctg15_99

Search NORINE for peptide: strict or relaxed

AMP-binding (499..903): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVaHVaK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

ctg15_100

Search NORINE for peptide: strict or relaxed

AMP-binding (485..891): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvSviGAICK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 70% (weak)

ctg15_104

Search NORINE for peptide: strict or relaxed

AMP-binding (36..428): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DgFllGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

c00018_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 224,481 - 245,506 nt. (total: 21,026 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00019_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 24,619 nt. (total: 24,619 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 24619:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg19_1

Search NORINE for peptide: strict or relaxed

AMP-binding (668..1073): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

c00023_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 30,776 nt. (total: 30,776 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 30776:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - asn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_1

Search NORINE for peptide: strict or relaxed

AMP-binding (549..947): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (1630..2048): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (2730..3123): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DpLniGAVcK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

c00027_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 8,463 nt. (total: 8,463 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8463:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn - glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg27_1

Search NORINE for peptide: strict or relaxed

AMP-binding (615..1031): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATaVGyVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 80% (moderate)

AMP-binding (1713..2115): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDLGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 100% (strong)

c00030_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 36,862 - 59,699 nt. (total: 22,838 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg30_39 - Putative Class II

allorf_042806_042955 leader / core peptide: VCCVRPGRLASCQAA - RHDhaLRAFQDhbDhaPHPLNDhaACWGPPCLDhaACLRDDGDDhb
allorf_046550_046765 leader / core peptide: MQQTDDIVLGWLSGSDSFDGMDNPAGPLYIEGAAATEAALTNPEAGSTLLTSVGG - DhaCDhaDhbCDhaLHLGGGCDhaCC
allorf_054650_054757 leader / core peptide: LLIVLANCYAPATREFAGS - CQCDhbDhaGVDhaDGERVDhaPL
allorf_054783_054947 leader / core peptide: LSLGKQPLPDSLCAVAAFLGA - ARRAGEKAPQRLFLLKKPPKWAPCFPVPADhbANR
allorf_059003_059185 leader / core peptide: MQKAMVRFG - DhaVDhaPHHFEFNMLGPALDhaVRMPDhaVRRLDRRPVCLRRRPFGLRDhbDRAGDDGDDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_042806_042955 - Class II

Cleavage pHMM score: -3.90

RODEO score: 0

Monoisotopic mass: 3599.7 Da

Molecular weight: 3602.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3620.0 Da N = 1; 3638.0 Da N = 2; 3656.0 Da N = 3

allorf_046550_046765 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 1426.5 Da

Molecular weight: 1427.7 Da

Number of bridges: 5

allorf_054650_054757 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 1564.7 Da

Molecular weight: 1565.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1583.7 Da N = 1; 1601.8 Da N = 2

allorf_054783_054947 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 3696.1 Da

Molecular weight: 3698.4 Da

Number of bridges: 1

allorf_059003_059185 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 5737.0 Da

Molecular weight: 5740.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5758.5 Da N = 1; 5776.5 Da N = 2; 5794.6 Da N = 3; 5812.6 Da N = 4; 5830.6 Da N = 5

c00032_3300025.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 48,784 nt. (total: 48,784 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 48784:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - mal) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_14

Search NORINE for peptide: strict or relaxed

AMP-binding (487..944): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DImqVgGVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

AMP-binding (1606..1999): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gevFcGVpVK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 50% (weak)

ctg32_15

Search NORINE for peptide: strict or relaxed

AMP-binding (49..443): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

PKS_AT (1165..1452): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 129.2
inactive: 78.0
Methoxymalonyl-CoA: 55.3
Methylmalonyl-CoA: 51.6
Propionyl-CoA: 34.7
Benzoyl-CoA: 29.2
Acetyl-CoA: 25.7
Ethylmalonyl-CoA: 23.0
2-Methylbutyryl-CoA: 22.5
CHC-CoA: 22.0
trans-1,2-CPDA: 20.1
Isobutyryl-CoA: 19.8
fatty_acid: 15.3
3-Methylbutyryl-CoA: 9.5

c00033_3300025.. - Region 1 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 116,662 - 148,866 nt. (total: 32,205 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg33_117 - Putative Class II

ctg33_114 leader / core peptide: MGTKKLPNASVQNVRGG - LYPELGFMDhbLDhbMGDhaPGQDhbPRRYDEPEYVQKMCRDhaKRKYAKDADhbLDhaRML
ctg33_115 leader / core peptide: MQQNDDVVSSWLNGTDSIGGLDNPAGPLYVDGATEKRMTSEAGA - QIMQDhbLLKDhbDhbQDhaCADhaGCACC
ctg33_116 leader / core peptide: MQQHDDVVSGWLSGSDNFGGLDNPAGPLYLDSATEEKMTSQVG - AAIFDhbDhbQKDhbDhaQDhaCADhaGCICC
allorf_140862_140933 leader / core peptide: VGTVAVLFS - GCRGANAEDhaDhbDhaAVK
allorf_141020_141163 leader / core peptide: MLRAKLGFHPSPWPSFLRKRRPFSASDAGQSIFA - FCMRANGLDhbDhaFRC
allorf_134998_135150 leader / core peptide: VLAEHSGDRRSVEAM - VRDhaHADMQGRRGLRRIKDhaEQDhbWCALFGDhbDFVRDIG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg33_114 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 5515.8 Da

Molecular weight: 5519.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5537.4 Da N = 1; 5555.4 Da N = 2; 5573.5 Da N = 3; 5591.5 Da N = 4; 5609.5 Da N = 5; 5627.5 Da N = 6

ctg33_115 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 1998.9 Da

Molecular weight: 2000.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2018.4 Da N = 1

ctg33_116 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1913.9 Da

Molecular weight: 1915.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1933.2 Da N = 1; 1951.3 Da N = 2

allorf_140862_140933 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1295.6 Da

Molecular weight: 1296.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1314.4 Da N = 1; 1332.4 Da N = 2

allorf_141020_141163 - Class II

Cleavage pHMM score: -4.80

RODEO score: 0

Monoisotopic mass: 1468.7 Da

Molecular weight: 1469.7 Da

Number of bridges: 2

allorf_134998_135150 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 3989.1 Da

Molecular weight: 3991.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4009.5 Da N = 1; 4027.5 Da N = 2; 4045.6 Da N = 3

c00040_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,859 nt. (total: 6,859 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg40_1

Search NORINE for peptide: strict or relaxed

AMP-binding (597..994): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DlknfGTdVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 50% (weak)

AMP-binding (1654..2048): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00041_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 47,299 - 70,031 nt. (total: 22,733 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.