3300025246_1 - 22 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300025.. (original name was: 3300025246.a:Ga0209646_1000009)

Region	Type	From	To
Region 1.1	T3PKS	320,477	361,592
Region 1.2	NRPS-like	518,554	561,640
Region 1.3	lanthipeptide	588,350	612,719

c00002_3300025.. (original name was: 3300025246.a:Ga0209646_1000037)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	terpene	304,007	324,978

c00004_3300025.. (original name was: 3300025246.a:Ga0209646_1000017)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	terpene	247,153	268,130
Region 4.2	lanthipeptide	429,605	452,322

c00005_3300025.. (original name was: 3300025246.a:Ga0209646_1000006)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	1	99,528
Region 5.2	bacteriocin	443,559	454,389

c00008_3300025.. (original name was: 3300025246.a:Ga0209646_1000003)

Region	Type	From	To
Region 8.1	lanthipeptide	535,806	554,366
Region 8.2	NRPS	741,817	830,669
Region 8.3	lanthipeptide	1,122,162	1,150,163

c00009_3300025.. (original name was: 3300025246.a:Ga0209646_1000025)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	lanthipeptide	1	28,762
Region 9.2	arylpolyene,resorcinol	250,445	296,790

c00010_3300025.. (original name was: 3300025246.a:Ga0209646_1000002)

Region	Type	From	To
Region 10.1	lanthipeptide	57,077	81,133
Region 10.2	terpene	273,777	294,497
Region 10.3	NRPS,T1PKS,lanthipeptide	435,339	520,457
Region 10.4	arylpolyene	636,938	686,816
Region 10.5	terpene	1,278,079	1,298,912

c00011_3300025.. (original name was: 3300025246.a:Ga0209646_1000004)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	microviridin	405,014	425,405

c00012_3300025.. (original name was: 3300025246.a:Ga0209646_1000050)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	siderophore	204,671	218,328

c00013_3300025.. (original name was: 3300025246.a:Ga0209646_1000091)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	T1PKS,hglE-KS	33,633	85,066
Region 13.2	terpene	168,514	188,727

Region	Type	From	To	Similarity
Region 1.1	T3PKS	320,477	361,592
Region 1.2	NRPS-like	518,554	561,640
Region 1.3	lanthipeptide	588,350	612,719
Region 2.1	terpene	304,007	324,978
Region 4.1	terpene	247,153	268,130
Region 4.2	lanthipeptide	429,605	452,322
Region 5.1	NRPS	1	99,528
Region 5.2	bacteriocin	443,559	454,389
Region 8.1	lanthipeptide	535,806	554,366
Region 8.2	NRPS	741,817	830,669
Region 8.3	lanthipeptide	1,122,162	1,150,163
Region 9.1	lanthipeptide	1	28,762
Region 9.2	arylpolyene,resorcinol	250,445	296,790
Region 10.1	lanthipeptide	57,077	81,133
Region 10.2	terpene	273,777	294,497
Region 10.3	NRPS,T1PKS,lanthipeptide	435,339	520,457
Region 10.4	arylpolyene	636,938	686,816
Region 10.5	terpene	1,278,079	1,298,912
Region 11.1	microviridin	405,014	425,405
Region 12.1	siderophore	204,671	218,328
Region 13.1	T1PKS,hglE-KS	33,633	85,066
Region 13.2	terpene	168,514	188,727

No secondary metabolite regions were found in these records:: c00003_3300025.. (original name was: 3300025246.a:Ga0209646_1000158); c00006_3300025.. (original name was: 3300025246.a:Ga0209646_1000031); c00007_3300025.. (original name was: 3300025246.a:Ga0209646_1000005); c00014_3300025.. (original name was: 3300025246.a:Ga0209646_1000045); c00015_3300025.. (original name was: 3300025246.a:Ga0209646_1000122)

Compact view

c00001_3300025.. - Region 1 - T3PKS

Download region GenBank file

Location: 320,477 - 361,592 nt. (total: 41,116 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00001_3300025.. - Region 2 - NRPS-like

Download region GenBank file

Location: 518,554 - 561,640 nt. (total: 43,087 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 518553 - 561640:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_412

Search NORINE for peptide: strict or relaxed

AMP-binding (38..430): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWfFGyIfK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00001_3300025.. - Region 3 - lanthipeptide

Download region GenBank file

Location: 588,350 - 612,719 nt. (total: 24,370 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_464 - Putative Class I

ctg1_461 leader / core peptide: MKKKKIELSKKLLLKKETIVELNQQQQAK - VAGGAPLDhbWWDhaACCVEDhbDEVDhbCPADCVR
ctg1_462 leader / core peptide: MKKKKVDLSKKLLFSKETIAQLTADQQAQVN - GGAADhbLAADhbCDhbEDDhbRLIDhaDhaCRADhbDhaPGPGRPCCMIP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg1_461 - Class I

Cleavage pHMM score: -11.10

RODEO score: 14

Monoisotopic mass: 2866.3 Da

Molecular weight: 2868.2 Da

Number of bridges: 4

ctg1_462 - Class I

Cleavage pHMM score: -13.70

RODEO score: 16

Monoisotopic mass: 3319.6 Da

Molecular weight: 3321.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3339.8 Da N = 1; 3357.9 Da N = 2; 3375.9 Da N = 3; 3393.9 Da N = 4

c00002_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 304,007 - 324,978 nt. (total: 20,972 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00004_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 247,153 - 268,130 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00004_3300025.. - Region 2 - lanthipeptide

Download region GenBank file

Location: 429,605 - 452,322 nt. (total: 22,718 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00005_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 99,528 nt. (total: 99,528 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 99528:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (ohmal) + (X - cys - ser) + (D-tyr - D-leu - val) + (tyr - gln) + (asp) + (D-X) + (asn) + (X) + (ohmal) + (asp - asn) + (X - D-orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_1

Search NORINE for peptide: strict or relaxed

AMP-binding (580..972): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg5_2

PKS_AT (9..293): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.3
inactive: 42.4
Methoxymalonyl-CoA: 32.5
Methylmalonyl-CoA: 31.7
Propionyl-CoA: 31.4
Benzoyl-CoA: 20.1
2-Methylbutyryl-CoA: 17.8
CHC-CoA: 13.7
Isobutyryl-CoA: 12.0
Ethylmalonyl-CoA: 12.0
Acetyl-CoA: 7.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

ctg5_4

Search NORINE for peptide: strict or relaxed

AMP-binding (258..652): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: phe, trp
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFAiGAVcK
Nearest Stachelhaus code:: haorn
Stachelhaus code match:: 80% (moderate)

AMP-binding (1337..1735): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

AMP-binding (2393..2795): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg5_5

Search NORINE for peptide: strict or relaxed

AMP-binding (546..939): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (2051..2441): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (3553..3950): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWvGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg5_7

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DSnnTAEiCK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

AMP-binding (1338..1733): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVnK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

ctg5_8

Search NORINE for peptide: strict or relaxed

AMP-binding (426..826): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

ctg5_10

Search NORINE for peptide: strict or relaxed

AMP-binding (259..649): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DglTIAGVnK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg5_11

Search NORINE for peptide: strict or relaxed

AMP-binding (472..866): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEiGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg5_12

Search NORINE for peptide: strict or relaxed

AMP-binding (239..628): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVcmIGaIcK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

ctg5_14

Search NORINE for peptide: strict or relaxed

AMP-binding (414..818): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

AMP-binding (1866..2149): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEiGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg5_15

Search NORINE for peptide: strict or relaxed

AMP-binding (240..626): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDaqISLAsK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 70% (weak)

AMP-binding (1288..1690): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00005_3300025.. - Region 2 - bacteriocin

Download region GenBank file

Location: 443,559 - 454,389 nt. (total: 10,831 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00008_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 535,806 - 554,366 nt. (total: 18,561 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00008_3300025.. - Region 2 - NRPS

Download region GenBank file

Location: 741,817 - 830,669 nt. (total: 88,853 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 741816 - 830669:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - leu - ala - ala - ala - ala - asn - X) + (asp - thr - ser - D-leu - X) + (asp) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg8_593

Search NORINE for peptide: strict or relaxed

AMP-binding (542..935): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

ctg8_594

Search NORINE for peptide: strict or relaxed

AMP-binding (537..930): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1590..1979): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2659..3046): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3722..4111): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (5218..5600): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMENaGavNK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

ctg8_595

Search NORINE for peptide: strict or relaxed

AMP-binding (530..902): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1564..1955): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2615..2989): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (3648..4022): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4679..5053): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (5714..6088): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (7134..7412): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (8072..8460): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgenVGAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

ctg8_596

CAL_domain (156..468): pk

minowa: NH2

Prediction, score:

NH2: 127.0
Acetyl-CoA: 34.6
fatty_acid: 27.2
shikimic_acid: 0.0
AHBA: 0.0

c00008_3300025.. - Region 3 - lanthipeptide

Download region GenBank file

Location: 1,122,162 - 1,150,163 nt. (total: 28,002 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00009_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 28,762 nt. (total: 28,762 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00009_3300025.. - Region 2 - arylpolyene,resorcinol

Download region GenBank file

Location: 250,445 - 296,790 nt. (total: 46,346 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
resorcinol: DarB

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00010_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 57,077 - 81,133 nt. (total: 24,057 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00010_3300025.. - Region 2 - terpene

Download region GenBank file

Location: 273,777 - 294,497 nt. (total: 20,721 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00010_3300025.. - Region 3 - NRPS,T1PKS,lanthipeptide

Download region GenBank file

Location: 435,339 - 520,457 nt. (total: 85,119 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 3, location 435338 - 520457:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X) + (X) + (X - orn - orn) + (X - cys) + (D-asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_402

Search NORINE for peptide: strict or relaxed

CAL_domain (48..477): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 194.9
NH2: 39.7
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1187..1475): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 148.1
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 53.2
Propionyl-CoA: 47.9
2-Methylbutyryl-CoA: 34.3
Isobutyryl-CoA: 24.0
Ethylmalonyl-CoA: 21.5
CHC-CoA: 18.8
Benzoyl-CoA: 18.7
Acetyl-CoA: 11.4
trans-1,2-CPDA: 10.9
3-Methylbutyryl-CoA: 10.9
fatty_acid: 0.0

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 100.0%; 2-Rhyd-Malonyl-CoA: 54.2%

AMP-binding (3080..3457): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHyShVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

ctg10_404

Search NORINE for peptide: strict or relaxed

AMP-binding (9..423): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg10_405

Search NORINE for peptide: strict or relaxed

AMP-binding (9..421): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg10_410

Search NORINE for peptide: strict or relaxed

AMP-binding (8..435): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

AMP-binding (1092..1495): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (2149..2552): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg10_412

Search NORINE for peptide: strict or relaxed

AMP-binding (5..429): X

NRPSPredictor2: pro, pip

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArhIAfliK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

AMP-binding (1086..1485): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

ctg10_413

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00010_3300025.. - Region 4 - arylpolyene

Download region GenBank file

Location: 636,938 - 686,816 nt. (total: 49,879 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00010_3300025.. - Region 5 - terpene

Download region GenBank file

Location: 1,278,079 - 1,298,912 nt. (total: 20,834 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00011_3300025.. - Region 1 - microviridin

Download region GenBank file

Location: 405,014 - 425,405 nt. (total: 20,392 nt) Show pHMM detection rules used

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00012_3300025.. - Region 1 - siderophore

Download region GenBank file

Location: 204,671 - 218,328 nt. (total: 13,658 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00013_3300025.. - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Location: 33,633 - 85,066 nt. (total: 51,434 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 33632 - 85066:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 33632 - 77922:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_52

PKS_AT (607..820): pk

minowa: inactive

Prediction, score:

inactive: 20.1
Methylmalonyl-CoA: 9.3
Malonyl-CoA: 1.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

ctg13_53

PKS_AT (1186..1473): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.5
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 24.2
inactive: 22.9
Propionyl-CoA: 14.7
fatty_acid: 9.2
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

c00013_3300025.. - Region 2 - terpene

Download region GenBank file

Location: 168,514 - 188,727 nt. (total: 20,214 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it