3300025250_3 - 27 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300025.. (original name was: 3300025250.a:Ga0209026_1001593)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS	1	9,735

c00002_3300025.. (original name was: 3300025250.a:Ga0209026_1000265)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	1	63,806

c00006_3300025.. (original name was: 3300025250.a:Ga0209026_1000272)

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	lanthipeptide	1	14,064

c00009_3300025.. (original name was: 3300025250.a:Ga0209026_1004136)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	NRPS	1	4,455

c00021_3300025.. (original name was: 3300025250.a:Ga0209026_1000268)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	terpene	11,805	32,638

c00027_3300025.. (original name was: 3300025250.a:Ga0209026_1000291)

Region	Type	From	To	Most similar known cluster		Similarity
Region 27.1	microviridin	32,199	52,360

c00034_3300025.. (original name was: 3300025250.a:Ga0209026_1000133)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	lanthipeptide	39,291	63,660
Region 34.2	NRPS-like	90,370	117,872

c00046_3300025.. (original name was: 3300025250.a:Ga0209026_1000303)

Region	Type	From	To	Most similar known cluster		Similarity
Region 46.1	lanthipeptide	1,447	38,662

c00048_3300025.. (original name was: 3300025250.a:Ga0209026_1000244)

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	lanthipeptide	54,217	69,490

c00058_3300025.. (original name was: 3300025250.a:Ga0209026_1000439)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	NRPS,bacteriocin	1	33,999

c00059_3300025.. (original name was: 3300025250.a:Ga0209026_1000240)

Region	Type	From	To	Most similar known cluster		Similarity
Region 59.1	siderophore	8,558	22,215

c00064_3300025.. (original name was: 3300025250.a:Ga0209026_1000262)

Region	Type	From	To	Most similar known cluster		Similarity
Region 64.1	bacteriocin	33,609	44,439

c00067_3300025.. (original name was: 3300025250.a:Ga0209026_1000168)

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	NRPS	64,698	100,138

c00073_3300025.. (original name was: 3300025250.a:Ga0209026_1000144)

Region	Type	From	To	Most similar known cluster		Similarity
Region 73.1	lanthipeptide	25,319	48,006

c00082_3300025.. (original name was: 3300025250.a:Ga0209026_1000880)

Region	Type	From	To	Most similar known cluster		Similarity
Region 82.1	terpene	3,766	15,642

c00084_3300025.. (original name was: 3300025250.a:Ga0209026_1000288)

Region	Type	From	To	Most similar known cluster		Similarity
Region 84.1	NRPS	1	53,385

c00085_3300025.. (original name was: 3300025250.a:Ga0209026_1000260)

Region	Type	From	To	Most similar known cluster		Similarity
Region 85.1	arylpolyene	1	34,630

c00105_3300025.. (original name was: 3300025250.a:Ga0209026_1000396)

Region	Type	From	To	Most similar known cluster		Similarity
Region 105.1	T3PKS	11,701	38,774

c00132_3300025.. (original name was: 3300025250.a:Ga0209026_1000793)

Region	Type	From	To	Most similar known cluster		Similarity
Region 132.1	NRPS	1	17,284

c00138_3300025.. (original name was: 3300025250.a:Ga0209026_1000189)

Region	Type	From	To	Most similar known cluster		Similarity
Region 138.1	resorcinol,arylpolyene	1	39,709

c00154_3300025.. (original name was: 3300025250.a:Ga0209026_1000263)

Region	Type	From	To	Most similar known cluster		Similarity
Region 154.1	lanthipeptide	18,305	44,585

c00155_3300025.. (original name was: 3300025250.a:Ga0209026_1000860)

Region	Type	From	To	Most similar known cluster		Similarity
Region 155.1	terpene	1	12,234

c00175_3300025.. (original name was: 3300025250.a:Ga0209026_1000497)

Region	Type	From	To	Most similar known cluster		Similarity
Region 175.1	T1PKS,hglE-KS	1	28,577

c00185_3300025.. (original name was: 3300025250.a:Ga0209026_1000429)

Region	Type	From	To	Most similar known cluster		Similarity
Region 185.1	NRPS	1	33,294

c00187_3300025.. (original name was: 3300025250.a:Ga0209026_1000218)

Region	Type	From	To	Most similar known cluster		Similarity
Region 187.1	T1PKS,NRPS,lanthipeptide	1	48,164

c00188_3300025.. (original name was: 3300025250.a:Ga0209026_1000229)

Region	Type	From	To	Most similar known cluster		Similarity
Region 188.1	terpene	62,495	76,521

Region	Type	From	To	Similarity
Region 1.1	NRPS	1	9,735
Region 2.1	NRPS	1	63,806
Region 6.1	lanthipeptide	1	14,064
Region 9.1	NRPS	1	4,455
Region 21.1	terpene	11,805	32,638
Region 27.1	microviridin	32,199	52,360
Region 34.1	lanthipeptide	39,291	63,660
Region 34.2	NRPS-like	90,370	117,872
Region 46.1	lanthipeptide	1,447	38,662
Region 48.1	lanthipeptide	54,217	69,490
Region 58.1	NRPS,bacteriocin	1	33,999
Region 59.1	siderophore	8,558	22,215
Region 64.1	bacteriocin	33,609	44,439
Region 67.1	NRPS	64,698	100,138
Region 73.1	lanthipeptide	25,319	48,006
Region 82.1	terpene	3,766	15,642
Region 84.1	NRPS	1	53,385
Region 85.1	arylpolyene	1	34,630
Region 105.1	T3PKS	11,701	38,774
Region 132.1	NRPS	1	17,284
Region 138.1	resorcinol,arylpolyene	1	39,709
Region 154.1	lanthipeptide	18,305	44,585
Region 155.1	terpene	1	12,234
Region 175.1	T1PKS,hglE-KS	1	28,577
Region 185.1	NRPS	1	33,294
Region 187.1	T1PKS,NRPS,lanthipeptide	1	48,164
Region 188.1	terpene	62,495	76,521

No secondary metabolite regions were found in these records:: c00003_3300025.. (original name was: 3300025250.a:Ga0209026_1004804); c00004_3300025.. (original name was: 3300025250.a:Ga0209026_1001044); c00005_3300025.. (original name was: 3300025250.a:Ga0209026_1000643); c00007_3300025.. (original name was: 3300025250.a:Ga0209026_1000232); c00008_3300025.. (original name was: 3300025250.a:Ga0209026_1000565); c00010_3300025.. (original name was: 3300025250.a:Ga0209026_1000156); c00011_3300025.. (original name was: 3300025250.a:Ga0209026_1000591); c00012_3300025.. (original name was: 3300025250.a:Ga0209026_1000308); c00013_3300025.. (original name was: 3300025250.a:Ga0209026_1001301); c00014_3300025.. (original name was: 3300025250.a:Ga0209026_1000644); c00015_3300025.. (original name was: 3300025250.a:Ga0209026_1001323); c00016_3300025.. (original name was: 3300025250.a:Ga0209026_1002316); c00017_3300025.. (original name was: 3300025250.a:Ga0209026_1001003); c00018_3300025.. (original name was: 3300025250.a:Ga0209026_1000185); c00019_3300025.. (original name was: 3300025250.a:Ga0209026_1000192); c00020_3300025.. (original name was: 3300025250.a:Ga0209026_1000209); c00022_3300025.. (original name was: 3300025250.a:Ga0209026_1000221); c00023_3300025.. (original name was: 3300025250.a:Ga0209026_1000314); c00024_3300025.. (original name was: 3300025250.a:Ga0209026_1001914); c00025_3300025.. (original name was: 3300025250.a:Ga0209026_1000322); c00026_3300025.. (original name was: 3300025250.a:Ga0209026_1000154); c00028_3300025.. (original name was: 3300025250.a:Ga0209026_1000582); c00029_3300025.. (original name was: 3300025250.a:Ga0209026_1000551); c00030_3300025.. (original name was: 3300025250.a:Ga0209026_1000401); c00031_3300025.. (original name was: 3300025250.a:Ga0209026_1000202); c00032_3300025.. (original name was: 3300025250.a:Ga0209026_1000611); c00033_3300025.. (original name was: 3300025250.a:Ga0209026_1000086); c00035_3300025.. (original name was: 3300025250.a:Ga0209026_1000178); c00036_3300025.. (original name was: 3300025250.a:Ga0209026_1000095); c00037_3300025.. (original name was: 3300025250.a:Ga0209026_1000136); c00038_3300025.. (original name was: 3300025250.a:Ga0209026_1003408); c00039_3300025.. (original name was: 3300025250.a:Ga0209026_1000954); c00040_3300025.. (original name was: 3300025250.a:Ga0209026_1000524); c00041_3300025.. (original name was: 3300025250.a:Ga0209026_1000195); c00042_3300025.. (original name was: 3300025250.a:Ga0209026_1000300); c00043_3300025.. (original name was: 3300025250.a:Ga0209026_1000698); c00044_3300025.. (original name was: 3300025250.a:Ga0209026_1002443); c00045_3300025.. (original name was: 3300025250.a:Ga0209026_1002642); c00047_3300025.. (original name was: 3300025250.a:Ga0209026_1000198); c00049_3300025.. (original name was: 3300025250.a:Ga0209026_1000446); c00050_3300025.. (original name was: 3300025250.a:Ga0209026_1001264); c00051_3300025.. (original name was: 3300025250.a:Ga0209026_1000349); c00052_3300025.. (original name was: 3300025250.a:Ga0209026_1002368); c00053_3300025.. (original name was: 3300025250.a:Ga0209026_1005309); c00054_3300025.. (original name was: 3300025250.a:Ga0209026_1000732); c00055_3300025.. (original name was: 3300025250.a:Ga0209026_1000334); c00056_3300025.. (original name was: 3300025250.a:Ga0209026_1000819); c00057_3300025.. (original name was: 3300025250.a:Ga0209026_1000410); c00060_3300025.. (original name was: 3300025250.a:Ga0209026_1000169); c00061_3300025.. (original name was: 3300025250.a:Ga0209026_1001652); c00062_3300025.. (original name was: 3300025250.a:Ga0209026_1001201); c00063_3300025.. (original name was: 3300025250.a:Ga0209026_1003048); c00065_3300025.. (original name was: 3300025250.a:Ga0209026_1000321); c00066_3300025.. (original name was: 3300025250.a:Ga0209026_1000354); c00068_3300025.. (original name was: 3300025250.a:Ga0209026_1000362); c00069_3300025.. (original name was: 3300025250.a:Ga0209026_1000329); c00070_3300025.. (original name was: 3300025250.a:Ga0209026_1002120); c00071_3300025.. (original name was: 3300025250.a:Ga0209026_1001101); c00072_3300025.. (original name was: 3300025250.a:Ga0209026_1000343); c00074_3300025.. (original name was: 3300025250.a:Ga0209026_1003609); c00075_3300025.. (original name was: 3300025250.a:Ga0209026_1000425); c00076_3300025.. (original name was: 3300025250.a:Ga0209026_1000823); c00077_3300025.. (original name was: 3300025250.a:Ga0209026_1000241); c00078_3300025.. (original name was: 3300025250.a:Ga0209026_1000894); c00079_3300025.. (original name was: 3300025250.a:Ga0209026_1001904); c00080_3300025.. (original name was: 3300025250.a:Ga0209026_1000312); c00081_3300025.. (original name was: 3300025250.a:Ga0209026_1000783); c00083_3300025.. (original name was: 3300025250.a:Ga0209026_1000686); c00086_3300025.. (original name was: 3300025250.a:Ga0209026_1005235); c00087_3300025.. (original name was: 3300025250.a:Ga0209026_1000252); c00088_3300025.. (original name was: 3300025250.a:Ga0209026_1002839); c00089_3300025.. (original name was: 3300025250.a:Ga0209026_1001287); c00090_3300025.. (original name was: 3300025250.a:Ga0209026_1000434); c00091_3300025.. (original name was: 3300025250.a:Ga0209026_1000979); c00092_3300025.. (original name was: 3300025250.a:Ga0209026_1000503); c00093_3300025.. (original name was: 3300025250.a:Ga0209026_1000220); c00094_3300025.. (original name was: 3300025250.a:Ga0209026_1004598); c00095_3300025.. (original name was: 3300025250.a:Ga0209026_1001397); c00096_3300025.. (original name was: 3300025250.a:Ga0209026_1000210); c00097_3300025.. (original name was: 3300025250.a:Ga0209026_1001083); c00098_3300025.. (original name was: 3300025250.a:Ga0209026_1000637); c00099_3300025.. (original name was: 3300025250.a:Ga0209026_1004168); c00100_3300025.. (original name was: 3300025250.a:Ga0209026_1000188); c00101_3300025.. (original name was: 3300025250.a:Ga0209026_1004765); c00102_3300025.. (original name was: 3300025250.a:Ga0209026_1001171); c00103_3300025.. (original name was: 3300025250.a:Ga0209026_1000773); c00104_3300025.. (original name was: 3300025250.a:Ga0209026_1001370); c00106_3300025.. (original name was: 3300025250.a:Ga0209026_1000197); c00107_3300025.. (original name was: 3300025250.a:Ga0209026_1000290); c00108_3300025.. (original name was: 3300025250.a:Ga0209026_1000545); c00109_3300025.. (original name was: 3300025250.a:Ga0209026_1001142); c00110_3300025.. (original name was: 3300025250.a:Ga0209026_1001535); c00111_3300025.. (original name was: 3300025250.a:Ga0209026_1001336); c00112_3300025.. (original name was: 3300025250.a:Ga0209026_1000500); c00113_3300025.. (original name was: 3300025250.a:Ga0209026_1000271); c00114_3300025.. (original name was: 3300025250.a:Ga0209026_1000470); c00115_3300025.. (original name was: 3300025250.a:Ga0209026_1001067); c00116_3300025.. (original name was: 3300025250.a:Ga0209026_1000452); c00117_3300025.. (original name was: 3300025250.a:Ga0209026_1001049); c00118_3300025.. (original name was: 3300025250.a:Ga0209026_1000344); c00119_3300025.. (original name was: 3300025250.a:Ga0209026_1000538); c00120_3300025.. (original name was: 3300025250.a:Ga0209026_1000403); c00121_3300025.. (original name was: 3300025250.a:Ga0209026_1001199); c00122_3300025.. (original name was: 3300025250.a:Ga0209026_1003134); c00123_3300025.. (original name was: 3300025250.a:Ga0209026_1000149); c00124_3300025.. (original name was: 3300025250.a:Ga0209026_1000547); c00125_3300025.. (original name was: 3300025250.a:Ga0209026_1000450); c00126_3300025.. (original name was: 3300025250.a:Ga0209026_1000418); c00127_3300025.. (original name was: 3300025250.a:Ga0209026_1001015); c00128_3300025.. (original name was: 3300025250.a:Ga0209026_1000166); c00129_3300025.. (original name was: 3300025250.a:Ga0209026_1000365); c00130_3300025.. (original name was: 3300025250.a:Ga0209026_1000196); c00131_3300025.. (original name was: 3300025250.a:Ga0209026_1000395); c00133_3300025.. (original name was: 3300025250.a:Ga0209026_1001312); c00134_3300025.. (original name was: 3300025250.a:Ga0209026_1000372); c00135_3300025.. (original name was: 3300025250.a:Ga0209026_1000256); c00136_3300025.. (original name was: 3300025250.a:Ga0209026_1000654); c00137_3300025.. (original name was: 3300025250.a:Ga0209026_1000587); c00139_3300025.. (original name was: 3300025250.a:Ga0209026_1000786); c00140_3300025.. (original name was: 3300025250.a:Ga0209026_1000656); c00141_3300025.. (original name was: 3300025250.a:Ga0209026_1000457); c00142_3300025.. (original name was: 3300025250.a:Ga0209026_1000182); c00143_3300025.. (original name was: 3300025250.a:Ga0209026_1002968); c00144_3300025.. (original name was: 3300025250.a:Ga0209026_1001663); c00145_3300025.. (original name was: 3300025250.a:Ga0209026_1004941); c00146_3300025.. (original name was: 3300025250.a:Ga0209026_1001449); c00147_3300025.. (original name was: 3300025250.a:Ga0209026_1000299); c00148_3300025.. (original name was: 3300025250.a:Ga0209026_1000697); c00149_3300025.. (original name was: 3300025250.a:Ga0209026_1001891); c00150_3300025.. (original name was: 3300025250.a:Ga0209026_1001073); c00151_3300025.. (original name was: 3300025250.a:Ga0209026_1001134); c00152_3300025.. (original name was: 3300025250.a:Ga0209026_1001631); c00153_3300025.. (original name was: 3300025250.a:Ga0209026_1000636); c00156_3300025.. (original name was: 3300025250.a:Ga0209026_1001046); c00157_3300025.. (original name was: 3300025250.a:Ga0209026_1002189); c00158_3300025.. (original name was: 3300025250.a:Ga0209026_1000995); c00159_3300025.. (original name was: 3300025250.a:Ga0209026_1000740); c00160_3300025.. (original name was: 3300025250.a:Ga0209026_1002548); c00161_3300025.. (original name was: 3300025250.a:Ga0209026_1000359); c00162_3300025.. (original name was: 3300025250.a:Ga0209026_1000757); c00163_3300025.. (original name was: 3300025250.a:Ga0209026_1000466); c00164_3300025.. (original name was: 3300025250.a:Ga0209026_1000233); c00165_3300025.. (original name was: 3300025250.a:Ga0209026_1001626); c00166_3300025.. (original name was: 3300025250.a:Ga0209026_1000631); c00167_3300025.. (original name was: 3300025250.a:Ga0209026_1000626); c00168_3300025.. (original name was: 3300025250.a:Ga0209026_1000495); c00169_3300025.. (original name was: 3300025250.a:Ga0209026_1000097); c00170_3300025.. (original name was: 3300025250.a:Ga0209026_1000296); c00171_3300025.. (original name was: 3300025250.a:Ga0209026_1000655); c00172_3300025.. (original name was: 3300025250.a:Ga0209026_1000977); c00173_3300025.. (original name was: 3300025250.a:Ga0209026_1000380); c00174_3300025.. (original name was: 3300025250.a:Ga0209026_1000298); c00176_3300025.. (original name was: 3300025250.a:Ga0209026_1001293); c00177_3300025.. (original name was: 3300025250.a:Ga0209026_1003798); c00178_3300025.. (original name was: 3300025250.a:Ga0209026_1000614); c00179_3300025.. (original name was: 3300025250.a:Ga0209026_1000216); c00180_3300025.. (original name was: 3300025250.a:Ga0209026_1000662); c00181_3300025.. (original name was: 3300025250.a:Ga0209026_1000371); c00182_3300025.. (original name was: 3300025250.a:Ga0209026_1003109); c00183_3300025.. (original name was: 3300025250.a:Ga0209026_1000721); c00184_3300025.. (original name was: 3300025250.a:Ga0209026_1000333); c00186_3300025.. (original name was: 3300025250.a:Ga0209026_1000019); c00189_3300025.. (original name was: 3300025250.a:Ga0209026_1000627); c00190_3300025.. (original name was: 3300025250.a:Ga0209026_1000826); c00191_3300025.. (original name was: 3300025250.a:Ga0209026_1000132); c00192_3300025.. (original name was: 3300025250.a:Ga0209026_1000530); c00193_3300025.. (original name was: 3300025250.a:Ga0209026_1002321); c00194_3300025.. (original name was: 3300025250.a:Ga0209026_1000075); c00195_3300025.. (original name was: 3300025250.a:Ga0209026_1001866); c00196_3300025.. (original name was: 3300025250.a:Ga0209026_1000473)

Compact view

c00001_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 9,735 nt. (total: 9,735 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9735:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1

Search NORINE for peptide: strict or relaxed

AMP-binding (235..629): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: phe, trp
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFAiGAVcK
Nearest Stachelhaus code:: haorn
Stachelhaus code match:: 80% (moderate)

c00002_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 63,806 nt. (total: 63,806 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 63806:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (D-tyr - D-leu - val) + (tyr - gln) + (asp) + (D-X) + (asn) + (X) + (ohmal) + (asp - asn) + (X - orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_1

Search NORINE for peptide: strict or relaxed

AMP-binding (240..626): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDaqISLAsK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 70% (weak)

AMP-binding (1288..1690): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg2_2

Search NORINE for peptide: strict or relaxed

AMP-binding (416..820): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

AMP-binding (1868..2151): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEiGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg2_4

Search NORINE for peptide: strict or relaxed

AMP-binding (239..628): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVcmIGaIcK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

ctg2_5

Search NORINE for peptide: strict or relaxed

AMP-binding (472..866): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEiGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg2_6

Search NORINE for peptide: strict or relaxed

AMP-binding (259..649): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DglTIAGVnK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg2_8

Search NORINE for peptide: strict or relaxed

AMP-binding (404..804): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

ctg2_9

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DSnnTAEiCK
Nearest Stachelhaus code:: his
Stachelhaus code match:: 70% (weak)

AMP-binding (1338..1733): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVnK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

ctg2_11

Search NORINE for peptide: strict or relaxed

AMP-binding (546..939): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DASTIAAVCK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 100% (strong)

AMP-binding (2051..2441): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (3553..3950): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWvGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg2_12

Search NORINE for peptide: strict or relaxed

AMP-binding (774..1176): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00006_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 14,064 nt. (total: 14,064 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00009_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,455 nt. (total: 4,455 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 4455:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg9_1

PKS_AT (9..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.3
inactive: 42.4
Methoxymalonyl-CoA: 32.5
Methylmalonyl-CoA: 31.7
Propionyl-CoA: 31.4
Benzoyl-CoA: 20.1
2-Methylbutyryl-CoA: 17.8
CHC-CoA: 13.7
Isobutyryl-CoA: 12.0
Ethylmalonyl-CoA: 12.0
Acetyl-CoA: 7.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

ctg9_2

Search NORINE for peptide: strict or relaxed

AMP-binding (542..934): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00021_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 11,805 - 32,638 nt. (total: 20,834 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00027_3300025.. - Region 1 - microviridin

Download region GenBank file

Location: 32,199 - 52,360 nt. (total: 20,162 nt) Show pHMM detection rules used

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00034_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 39,291 - 63,660 nt. (total: 24,370 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg34_38 - Putative Class I

ctg34_40 leader / core peptide: MKKKKIELSKKLLLKKETIVELNQQQQAK - VAGGAPLDhbWWDhaACCVEDhbDEVDhbCPADCVR
allorf_053766_053966 leader / core peptide: MKKKKVDLSKKLLFSKETIAQLTADQQAQVN - GGAADhbLAADhbCDhbEDDhbRLIDhaDhaCRADhbDhaPGPGRPCCMIP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg34_40 - Class I

Cleavage pHMM score: -11.10

RODEO score: 14

Monoisotopic mass: 2866.3 Da

Molecular weight: 2868.2 Da

Number of bridges: 4

allorf_053766_053966 - Class I

Cleavage pHMM score: -13.70

RODEO score: 16

Monoisotopic mass: 3319.6 Da

Molecular weight: 3321.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3339.8 Da N = 1; 3357.9 Da N = 2; 3375.9 Da N = 3; 3393.9 Da N = 4

c00034_3300025.. - Region 2 - NRPS-like

Download region GenBank file

Location: 90,370 - 117,872 nt. (total: 27,503 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 90369 - 117872:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_90

Search NORINE for peptide: strict or relaxed

AMP-binding (38..430): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWfFGyIfK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00046_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1,447 - 38,662 nt. (total: 37,216 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00048_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 54,217 - 69,490 nt. (total: 15,274 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00058_3300025.. - Region 1 - NRPS,bacteriocin

Download region GenBank file

Location: 1 - 33,999 nt. (total: 33,999 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 33999:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln) + (X - val - thr - leu) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_1

Search NORINE for peptide: strict or relaxed

AMP-binding (555..950): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVnK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

CAL_domain (1855..2292): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 35.9
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

ctg58_2

Search NORINE for peptide: strict or relaxed

AMP-binding (262..652): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: tDlqISLAtK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 60% (weak)

AMP-binding (1304..1701): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2357..2762): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DvWaIcMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 70% (weak)

AMP-binding (3420..3808): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg58_4

Search NORINE for peptide: strict or relaxed

AMP-binding (1765..2162): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2837..3160): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

c00059_3300025.. - Region 1 - siderophore

Download region GenBank file

Location: 8,558 - 22,215 nt. (total: 13,658 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00064_3300025.. - Region 1 - bacteriocin

Download region GenBank file

Location: 33,609 - 44,439 nt. (total: 10,831 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00067_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 64,698 - 100,138 nt. (total: 35,441 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 64697 - 100138:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (lys - lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg67_80

Search NORINE for peptide: strict or relaxed

CAL_domain (505..946): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 147.3
NH2: 40.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

AMP-binding (1590..1980): lys

NRPSPredictor2: lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: lys

Stachelhaus prediction details:

Stachelhaus sequence:: DtESIGtVCK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 80% (moderate)

AMP-binding (2639..3023): lys

NRPSPredictor2: lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DtESIGtVCK
Nearest Stachelhaus code:: lys
Stachelhaus code match:: 80% (moderate)

ctg67_81

Search NORINE for peptide: strict or relaxed

AMP-binding (263..465): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQ------K
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 40% (weak)

c00073_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 25,319 - 48,006 nt. (total: 22,688 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00082_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 3,766 - 15,642 nt. (total: 11,877 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00084_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 53,385 nt. (total: 53,385 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 53385:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala - leu - ala - asn - X) + (asp - thr - ser - D-leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg84_1

Search NORINE for peptide: strict or relaxed

AMP-binding (537..930): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1590..1979): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2659..3046): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3722..4111): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg84_2

Search NORINE for peptide: strict or relaxed

AMP-binding (548..920): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (1582..1973): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2633..3007): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

AMP-binding (4053..4331): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (4991..5379): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgenVGAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

ctg84_3

CAL_domain (156..468): pk

minowa: NH2

Prediction, score:

NH2: 127.0
Acetyl-CoA: 34.6
fatty_acid: 27.2
shikimic_acid: 0.0
AHBA: 0.0

c00085_3300025.. - Region 1 - arylpolyene

Download region GenBank file

Location: 1 - 34,630 nt. (total: 34,630 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00105_3300025.. - Region 1 - T3PKS

Download region GenBank file

Location: 11,701 - 38,774 nt. (total: 27,074 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00132_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 17,284 nt. (total: 17,284 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17284:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (asp) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg132_1

Search NORINE for peptide: strict or relaxed

AMP-binding (344..726): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMENaGavNK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

ctg132_2

Search NORINE for peptide: strict or relaxed

AMP-binding (542..935): asp

NRPSPredictor2: asp

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKiGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 90% (moderate)

c00138_3300025.. - Region 1 - arylpolyene,resorcinol

Download region GenBank file

Location: 1 - 39,709 nt. (total: 39,709 nt) Show pHMM detection rules used

Region on contig edge.

resorcinol: DarB
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00154_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 18,305 - 44,585 nt. (total: 26,281 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00155_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 1 - 12,234 nt. (total: 12,234 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00175_3300025.. - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Location: 1 - 28,577 nt. (total: 28,577 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 28577:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg175_18

PKS_AT (607..820): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 20.1
Methylmalonyl-CoA: 9.3
Malonyl-CoA: 1.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg175_19

PKS_AT (1186..1473): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 75.5
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 24.2
inactive: 22.9
Propionyl-CoA: 14.7
fatty_acid: 9.2
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

c00185_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 33,294 nt. (total: 33,294 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 33294:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - cys) + (D-asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg185_4

Search NORINE for peptide: strict or relaxed

AMP-binding (14..438): X

NRPSPredictor2: pro, pip

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArhIAfliK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 50% (weak)

AMP-binding (1095..1494): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLydFSLVWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 80% (moderate)

ctg185_5

Search NORINE for peptide: strict or relaxed

AMP-binding (263..660): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00187_3300025.. - Region 1 - NRPS,T1PKS,lanthipeptide

Download region GenBank file

Location: 1 - 48,164 nt. (total: 48,164 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 0 - 48164:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg187_1

Search NORINE for peptide: strict or relaxed

AMP-binding (8..435): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg187_6

Search NORINE for peptide: strict or relaxed

AMP-binding (9..421): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg187_7

Search NORINE for peptide: strict or relaxed

AMP-binding (9..423): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArHLaLLaK
Nearest Stachelhaus code:: hpg
Stachelhaus code match:: 70% (weak)

ctg187_9

Search NORINE for peptide: strict or relaxed

CAL_domain (48..477): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 194.9
NH2: 39.7
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1187..1475): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 100.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 148.1
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 53.2
Propionyl-CoA: 47.9
2-Methylbutyryl-CoA: 34.3
Isobutyryl-CoA: 24.0
Ethylmalonyl-CoA: 21.5
CHC-CoA: 18.8
Benzoyl-CoA: 18.7
Acetyl-CoA: 11.4
trans-1,2-CPDA: 10.9
3-Methylbutyryl-CoA: 10.9
fatty_acid: 0.0

AMP-binding (3080..3457): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHyShVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00188_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 62,495 - 76,521 nt. (total: 14,027 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it