3300025254_12 - 13 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00005_3300025.. (original name was: 3300025254.a:Ga0209148_1000125)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS,T1PKS	58,147	112,195

c00008_3300025.. (original name was: 3300025254.a:Ga0209148_1000045)

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	indole	421,910	443,889

c00009_3300025.. (original name was: 3300025254.a:Ga0209148_1000063)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	terpene	101,407	122,432

c00012_3300025.. (original name was: 3300025254.a:Ga0209148_1000024)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	lanthipeptide,bacteriocin	47,904	80,108
Region 12.2	NRPS	226,899	283,211

c00018_3300025.. (original name was: 3300025254.a:Ga0209148_1000326)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	NRPS	34,304	66,036

c00021_3300025.. (original name was: 3300025254.a:Ga0209148_1000058)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	lanthipeptide	70,222	93,059

c00024_3300025.. (original name was: 3300025254.a:Ga0209148_1000079)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	NRPS,arylpolyene	155,602	242,369

c00026_3300025.. (original name was: 3300025254.a:Ga0209148_1000073)

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	arylpolyene	23,722	71,031
Region 26.2	NRPS	192,071	236,081

c00029_3300025.. (original name was: 3300025254.a:Ga0209148_1000042)

Region	Type	From	To
Region 29.1	terpene	260,823	283,466
Region 29.2	bacteriocin	317,167	328,024
Region 29.3	terpene	347,235	367,876

Region	Type	From	To	Similarity
Region 5.1	NRPS,T1PKS	58,147	112,195
Region 8.1	indole	421,910	443,889
Region 9.1	terpene	101,407	122,432
Region 12.1	lanthipeptide,bacteriocin	47,904	80,108
Region 12.2	NRPS	226,899	283,211
Region 18.1	NRPS	34,304	66,036
Region 21.1	lanthipeptide	70,222	93,059
Region 24.1	NRPS,arylpolyene	155,602	242,369
Region 26.1	arylpolyene	23,722	71,031
Region 26.2	NRPS	192,071	236,081
Region 29.1	terpene	260,823	283,466
Region 29.2	bacteriocin	317,167	328,024
Region 29.3	terpene	347,235	367,876

No secondary metabolite regions were found in these records:: c00001_3300025.. (original name was: 3300025254.a:Ga0209148_1000304); c00002_3300025.. (original name was: 3300025254.a:Ga0209148_1000309); c00003_3300025.. (original name was: 3300025254.a:Ga0209148_1000245); c00004_3300025.. (original name was: 3300025254.a:Ga0209148_1000359); c00006_3300025.. (original name was: 3300025254.a:Ga0209148_1001032); c00007_3300025.. (original name was: 3300025254.a:Ga0209148_1001643); c00010_3300025.. (original name was: 3300025254.a:Ga0209148_1001003); c00011_3300025.. (original name was: 3300025254.a:Ga0209148_1000635); c00013_3300025.. (original name was: 3300025254.a:Ga0209148_1000201); c00014_3300025.. (original name was: 3300025254.a:Ga0209148_1000062); c00015_3300025.. (original name was: 3300025254.a:Ga0209148_1000039); c00016_3300025.. (original name was: 3300025254.a:Ga0209148_1000681); c00017_3300025.. (original name was: 3300025254.a:Ga0209148_1000775); c00019_3300025.. (original name was: 3300025254.a:Ga0209148_1000138); c00020_3300025.. (original name was: 3300025254.a:Ga0209148_1000340); c00022_3300025.. (original name was: 3300025254.a:Ga0209148_1000473); c00023_3300025.. (original name was: 3300025254.a:Ga0209148_1000657); c00025_3300025.. (original name was: 3300025254.a:Ga0209148_1000220); c00027_3300025.. (original name was: 3300025254.a:Ga0209148_1000214); c00028_3300025.. (original name was: 3300025254.a:Ga0209148_1000176); c00030_3300025.. (original name was: 3300025254.a:Ga0209148_1000371); c00031_3300025.. (original name was: 3300025254.a:Ga0209148_1000205)

Compact view

c00005_3300025.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 58,147 - 112,195 nt. (total: 54,049 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 58146 - 112195:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val - mal) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_75

Search NORINE for peptide: strict or relaxed

AMP-binding (487..944): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DImqVgGVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

AMP-binding (1606..1999): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gevFcGVpVK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 50% (weak)

ctg5_76

Search NORINE for peptide: strict or relaxed

AMP-binding (178..572): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

PKS_AT (1294..1582): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 128.6
inactive: 77.6
Methoxymalonyl-CoA: 54.2
Methylmalonyl-CoA: 50.2
Propionyl-CoA: 34.4
Benzoyl-CoA: 27.9
Acetyl-CoA: 25.2
2-Methylbutyryl-CoA: 22.8
CHC-CoA: 21.1
Ethylmalonyl-CoA: 20.6
Isobutyryl-CoA: 18.8
trans-1,2-CPDA: 18.1
fatty_acid: 12.5
3-Methylbutyryl-CoA: 9.6

c00008_3300025.. - Region 1 - indole

Download region GenBank file

Location: 421,910 - 443,889 nt. (total: 21,980 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00009_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 101,407 - 122,432 nt. (total: 21,026 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00012_3300025.. - Region 1 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 47,904 - 80,108 nt. (total: 32,205 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg12_49 - Putative Class II

ctg12_50 leader / core peptide: MQQHDDVVSGWLSGSDNFGGLDNPAGPLYLDSATEEKMTSQVG - AAIFDhbDhbQKDhbDhaQDhaCADhaGCICC
ctg12_51 leader / core peptide: MQQNDDVVSSWLNGTDSIGGLDNPAGPLYVDGDTEKRMTSEAGA - QIMQDhbLLKDhbDhbQDhaCADhaGCACC
allorf_052816_053001 leader / core peptide: MCSEHPPPCALGDPRKQGGDVAARRIVAS - LVEAPLYIQCDhaELKDARGFPGLRRHYRNPAHP
allorf_061383_061589 leader / core peptide: LIPMGTKKLPNASVQNVRGG - LYPELGFMDhbLDhbMGDhaPGQDhbPRRYDEPEYVQKMCRDhaKRKYAKDADhbLDhaRML
allorf_061620_061772 leader / core peptide: VLAEHSGDRRSVEAM - VRDhaHADMQGRRGLRRIKDhaEQDhbWCALFGDhbDFVRDIG
allorf_055831_055902 leader / core peptide: VGTVAVLFS - GCRGANAEDhaDhbDhaAVK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg12_50 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1913.9 Da

Molecular weight: 1915.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1933.2 Da N = 1; 1951.3 Da N = 2

ctg12_51 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 1998.9 Da

Molecular weight: 2000.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2018.4 Da N = 1

allorf_052816_053001 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 3684.9 Da

Molecular weight: 3687.2 Da

Number of bridges: 1

allorf_061383_061589 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 5515.8 Da

Molecular weight: 5519.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5537.4 Da N = 1; 5555.4 Da N = 2; 5573.5 Da N = 3; 5591.5 Da N = 4; 5609.5 Da N = 5; 5627.5 Da N = 6

allorf_061620_061772 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 3989.1 Da

Molecular weight: 3991.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4009.5 Da N = 1; 4027.5 Da N = 2; 4045.6 Da N = 3

allorf_055831_055902 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1295.6 Da

Molecular weight: 1296.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1314.4 Da N = 1; 1332.4 Da N = 2

c00012_3300025.. - Region 2 - NRPS

Download region GenBank file

Location: 226,899 - 283,211 nt. (total: 56,313 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 226898 - 283211:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (tyr - X) + (thr - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg12_187

Search NORINE for peptide: strict or relaxed

AMP-binding (464..866): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DALtVGhVlK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

AMP-binding (1530..1941): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: gAfFFGLVlK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 70% (weak)

ctg12_190

Search NORINE for peptide: strict or relaxed

AMP-binding (538..940): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1605..2010): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHLSLvDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

c00018_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 34,304 - 66,036 nt. (total: 31,733 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 34303 - 66036:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg18_60

Search NORINE for peptide: strict or relaxed

AMP-binding (474..887): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DVWiIGAVlK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 80% (moderate)

AMP-binding (1541..1932): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vpknTAnlnK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 30% (weak)

c00021_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 70,222 - 93,059 nt. (total: 22,838 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg21_58 - Putative Class II

ctg21_59 leader / core peptide: MQQTDDIVLGWLSGSDSFDGMDNPAGPLYIEGAAATEAALTNPEAGSTLLTSVGG - DhaCDhaDhbCDhaLHLGGGCDhaCC
allorf_070568_070750 leader / core peptide: MQKAMVRFG - DhaVDhaPHHFEFNMLGPALDhaVRMPDhaVRRLDRRPVCLRRRPFGLRDhbDRAGDDGDDhb
allorf_073421_073621 leader / core peptide: VACVAGMAEAAWPQRSTQVAEKPAIPVVARCLARGRRAAWFAA - AGHAGKVFPDRDhaDhaRLAPCGICIR
allorf_074974_075138 leader / core peptide: LSLGKQPLPDSLCAVAAFLGA - ARRAGEKAPQRLFLLKKPPKWAPCFPVPADhbANR
allorf_075164_075271 leader / core peptide: LLIVLANCYAPATREFAGS - CQCDhbDhaGVDhaDGERVDhaPL
allorf_087026_087112 leader / core peptide: VLRGAGKTGRLAKPRGA - DhaCGPDhaRHHPIL

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg21_59 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 1426.5 Da

Molecular weight: 1427.7 Da

Number of bridges: 5

allorf_070568_070750 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 5737.0 Da

Molecular weight: 5740.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5758.5 Da N = 1; 5776.5 Da N = 2; 5794.6 Da N = 3; 5812.6 Da N = 4; 5830.6 Da N = 5

allorf_073421_073621 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 2374.2 Da

Molecular weight: 2375.8 Da

Number of bridges: 2

allorf_074974_075138 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 3696.1 Da

Molecular weight: 3698.4 Da

Number of bridges: 1

allorf_075164_075271 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 1564.7 Da

Molecular weight: 1565.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1583.7 Da N = 1; 1601.8 Da N = 2

allorf_087026_087112 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 1166.6 Da

Molecular weight: 1167.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1185.4 Da N = 1

c00024_3300025.. - Region 1 - NRPS,arylpolyene

Download region GenBank file

Location: 155,602 - 242,369 nt. (total: 86,768 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 155601 - 242369:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 155601 - 218140:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg24_148

Search NORINE for peptide: strict or relaxed

AMP-binding (24..302): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gvMV-----K
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 30% (weak)

ctg24_160

Search NORINE for peptide: strict or relaxed

AMP-binding (499..903): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVaHVaK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

ctg24_161

Search NORINE for peptide: strict or relaxed

AMP-binding (485..891): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvSviGAICK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 70% (weak)

ctg24_165

Search NORINE for peptide: strict or relaxed

AMP-binding (36..428): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DgflLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

c00026_3300025.. - Region 1 - arylpolyene

Download region GenBank file

Location: 23,722 - 71,031 nt. (total: 47,310 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00026_3300025.. - Region 2 - NRPS

Download region GenBank file

Location: 192,071 - 236,081 nt. (total: 44,011 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 192070 - 236081:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg26_207

Search NORINE for peptide: strict or relaxed

AMP-binding (465..855): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DILwLGLVlK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

c00029_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 260,823 - 283,466 nt. (total: 22,644 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00029_3300025.. - Region 2 - bacteriocin

Download region GenBank file

Location: 317,167 - 328,024 nt. (total: 10,858 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00029_3300025.. - Region 3 - terpene

Download region GenBank file

Location: 347,235 - 367,876 nt. (total: 20,642 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it