3300025256_10 - 12 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00032_3300025.. (original name was: 3300025256.a:Ga0209759_1000789)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS	1	26,247

c00034_3300025.. (original name was: 3300025256.a:Ga0209759_1000165)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	NRPS,arylpolyene	1	76,396

c00121_3300025.. (original name was: 3300025256.a:Ga0209759_1000992)

Region	Type	From	To	Most similar known cluster		Similarity
Region 121.1	lanthipeptide,bacteriocin	1	19,464

c00122_3300025.. (original name was: 3300025256.a:Ga0209759_1000760)

Region	Type	From	To	Most similar known cluster		Similarity
Region 122.1	NRPS	1	27,224

c00159_3300025.. (original name was: 3300025256.a:Ga0209759_1002753)

Region	Type	From	To	Most similar known cluster		Similarity
Region 159.1	NRPS	1	7,462

c00174_3300025.. (original name was: 3300025256.a:Ga0209759_1006861)

Region	Type	From	To	Most similar known cluster		Similarity
Region 174.1	T1PKS	1	3,764

c00182_3300025.. (original name was: 3300025256.a:Ga0209759_1000185)

Region	Type	From	To	Most similar known cluster		Similarity
Region 182.1	terpene	15,492	38,646
Region 182.2	bacteriocin	72,327	83,184

c00190_3300025.. (original name was: 3300025256.a:Ga0209759_1000176)

Region	Type	From	To	Most similar known cluster		Similarity
Region 190.1	terpene	12,336	33,361

c00214_3300025.. (original name was: 3300025256.a:Ga0209759_1000103)

Region	Type	From	To	Most similar known cluster		Similarity
Region 214.1	arylpolyene	29,502	76,811
Region 214.2	terpene	96,656	117,519

c00223_3300025.. (original name was: 3300025256.a:Ga0209759_1000247)

Region	Type	From	To	Most similar known cluster		Similarity
Region 223.1	indole	4,135	26,114

Region	Type	From	To	Similarity
Region 32.1	NRPS	1	26,247
Region 34.1	NRPS,arylpolyene	1	76,396
Region 121.1	lanthipeptide,bacteriocin	1	19,464
Region 122.1	NRPS	1	27,224
Region 159.1	NRPS	1	7,462
Region 174.1	T1PKS	1	3,764
Region 182.1	terpene	15,492	38,646
Region 182.2	bacteriocin	72,327	83,184
Region 190.1	terpene	12,336	33,361
Region 214.1	arylpolyene	29,502	76,811
Region 214.2	terpene	96,656	117,519
Region 223.1	indole	4,135	26,114

No secondary metabolite regions were found in these records:: c00001_3300025.. (original name was: 3300025256.a:Ga0209759_1008044); c00002_3300025.. (original name was: 3300025256.a:Ga0209759_1001727); c00003_3300025.. (original name was: 3300025256.a:Ga0209759_1005673); c00004_3300025.. (original name was: 3300025256.a:Ga0209759_1003590); c00005_3300025.. (original name was: 3300025256.a:Ga0209759_1001967); c00006_3300025.. (original name was: 3300025256.a:Ga0209759_1001302); c00007_3300025.. (original name was: 3300025256.a:Ga0209759_1008394); c00008_3300025.. (original name was: 3300025256.a:Ga0209759_1006310); c00009_3300025.. (original name was: 3300025256.a:Ga0209759_1004896); c00010_3300025.. (original name was: 3300025256.a:Ga0209759_1004614); c00011_3300025.. (original name was: 3300025256.a:Ga0209759_1002470); c00012_3300025.. (original name was: 3300025256.a:Ga0209759_1001794); c00013_3300025.. (original name was: 3300025256.a:Ga0209759_1001481); c00014_3300025.. (original name was: 3300025256.a:Ga0209759_1001202); c00015_3300025.. (original name was: 3300025256.a:Ga0209759_1000451); c00016_3300025.. (original name was: 3300025256.a:Ga0209759_1001120); c00017_3300025.. (original name was: 3300025256.a:Ga0209759_1003464); c00018_3300025.. (original name was: 3300025256.a:Ga0209759_1002777); c00019_3300025.. (original name was: 3300025256.a:Ga0209759_1001876); c00020_3300025.. (original name was: 3300025256.a:Ga0209759_1001290); c00021_3300025.. (original name was: 3300025256.a:Ga0209759_1001257); c00022_3300025.. (original name was: 3300025256.a:Ga0209759_1000907); c00023_3300025.. (original name was: 3300025256.a:Ga0209759_1001106); c00024_3300025.. (original name was: 3300025256.a:Ga0209759_1007170); c00025_3300025.. (original name was: 3300025256.a:Ga0209759_1001399); c00026_3300025.. (original name was: 3300025256.a:Ga0209759_1000802); c00027_3300025.. (original name was: 3300025256.a:Ga0209759_1000962); c00028_3300025.. (original name was: 3300025256.a:Ga0209759_1005738); c00029_3300025.. (original name was: 3300025256.a:Ga0209759_1005904); c00030_3300025.. (original name was: 3300025256.a:Ga0209759_1000730); c00031_3300025.. (original name was: 3300025256.a:Ga0209759_1000929); c00033_3300025.. (original name was: 3300025256.a:Ga0209759_1000887); c00035_3300025.. (original name was: 3300025256.a:Ga0209759_1003773); c00036_3300025.. (original name was: 3300025256.a:Ga0209759_1003157); c00037_3300025.. (original name was: 3300025256.a:Ga0209759_1003372); c00038_3300025.. (original name was: 3300025256.a:Ga0209759_1005163); c00039_3300025.. (original name was: 3300025256.a:Ga0209759_1007103); c00040_3300025.. (original name was: 3300025256.a:Ga0209759_1000968); c00041_3300025.. (original name was: 3300025256.a:Ga0209759_1000559); c00042_3300025.. (original name was: 3300025256.a:Ga0209759_1005787); c00043_3300025.. (original name was: 3300025256.a:Ga0209759_1006951); c00044_3300025.. (original name was: 3300025256.a:Ga0209759_1000670); c00045_3300025.. (original name was: 3300025256.a:Ga0209759_1008431); c00046_3300025.. (original name was: 3300025256.a:Ga0209759_1008720); c00047_3300025.. (original name was: 3300025256.a:Ga0209759_1000410); c00048_3300025.. (original name was: 3300025256.a:Ga0209759_1001465); c00049_3300025.. (original name was: 3300025256.a:Ga0209759_1004550); c00050_3300025.. (original name was: 3300025256.a:Ga0209759_1008231); c00051_3300025.. (original name was: 3300025256.a:Ga0209759_1000211); c00052_3300025.. (original name was: 3300025256.a:Ga0209759_1001847); c00053_3300025.. (original name was: 3300025256.a:Ga0209759_1001237); c00054_3300025.. (original name was: 3300025256.a:Ga0209759_1001028); c00055_3300025.. (original name was: 3300025256.a:Ga0209759_1000829); c00056_3300025.. (original name was: 3300025256.a:Ga0209759_1004256); c00057_3300025.. (original name was: 3300025256.a:Ga0209759_1000674); c00058_3300025.. (original name was: 3300025256.a:Ga0209759_1002080); c00059_3300025.. (original name was: 3300025256.a:Ga0209759_1005595); c00060_3300025.. (original name was: 3300025256.a:Ga0209759_1000687); c00061_3300025.. (original name was: 3300025256.a:Ga0209759_1004117); c00062_3300025.. (original name was: 3300025256.a:Ga0209759_1000137); c00063_3300025.. (original name was: 3300025256.a:Ga0209759_1000862); c00064_3300025.. (original name was: 3300025256.a:Ga0209759_1001249); c00065_3300025.. (original name was: 3300025256.a:Ga0209759_1000799); c00066_3300025.. (original name was: 3300025256.a:Ga0209759_1004456); c00067_3300025.. (original name was: 3300025256.a:Ga0209759_1001324); c00068_3300025.. (original name was: 3300025256.a:Ga0209759_1004081); c00069_3300025.. (original name was: 3300025256.a:Ga0209759_1001328); c00070_3300025.. (original name was: 3300025256.a:Ga0209759_1000589); c00071_3300025.. (original name was: 3300025256.a:Ga0209759_1003043); c00072_3300025.. (original name was: 3300025256.a:Ga0209759_1005872); c00073_3300025.. (original name was: 3300025256.a:Ga0209759_1001782); c00074_3300025.. (original name was: 3300025256.a:Ga0209759_1001200); c00075_3300025.. (original name was: 3300025256.a:Ga0209759_1001609); c00076_3300025.. (original name was: 3300025256.a:Ga0209759_1000904); c00077_3300025.. (original name was: 3300025256.a:Ga0209759_1004702); c00078_3300025.. (original name was: 3300025256.a:Ga0209759_1006448); c00079_3300025.. (original name was: 3300025256.a:Ga0209759_1003099); c00080_3300025.. (original name was: 3300025256.a:Ga0209759_1001012); c00081_3300025.. (original name was: 3300025256.a:Ga0209759_1003875); c00082_3300025.. (original name was: 3300025256.a:Ga0209759_1000428); c00083_3300025.. (original name was: 3300025256.a:Ga0209759_1001622); c00084_3300025.. (original name was: 3300025256.a:Ga0209759_1002022); c00085_3300025.. (original name was: 3300025256.a:Ga0209759_1001204); c00086_3300025.. (original name was: 3300025256.a:Ga0209759_1000596); c00087_3300025.. (original name was: 3300025256.a:Ga0209759_1001005); c00088_3300025.. (original name was: 3300025256.a:Ga0209759_1001787); c00089_3300025.. (original name was: 3300025256.a:Ga0209759_1003423); c00090_3300025.. (original name was: 3300025256.a:Ga0209759_1000969); c00091_3300025.. (original name was: 3300025256.a:Ga0209759_1002561); c00092_3300025.. (original name was: 3300025256.a:Ga0209759_1006953); c00093_3300025.. (original name was: 3300025256.a:Ga0209759_1000784); c00094_3300025.. (original name was: 3300025256.a:Ga0209759_1004008); c00095_3300025.. (original name was: 3300025256.a:Ga0209759_1004431); c00096_3300025.. (original name was: 3300025256.a:Ga0209759_1000750); c00097_3300025.. (original name was: 3300025256.a:Ga0209759_1000888); c00098_3300025.. (original name was: 3300025256.a:Ga0209759_1003342); c00099_3300025.. (original name was: 3300025256.a:Ga0209759_1005786); c00100_3300025.. (original name was: 3300025256.a:Ga0209759_1002997); c00101_3300025.. (original name was: 3300025256.a:Ga0209759_1000134); c00102_3300025.. (original name was: 3300025256.a:Ga0209759_1003406); c00103_3300025.. (original name was: 3300025256.a:Ga0209759_1002212); c00104_3300025.. (original name was: 3300025256.a:Ga0209759_1007751); c00105_3300025.. (original name was: 3300025256.a:Ga0209759_1004841); c00106_3300025.. (original name was: 3300025256.a:Ga0209759_1001458); c00107_3300025.. (original name was: 3300025256.a:Ga0209759_1005479); c00108_3300025.. (original name was: 3300025256.a:Ga0209759_1000571); c00109_3300025.. (original name was: 3300025256.a:Ga0209759_1003843); c00110_3300025.. (original name was: 3300025256.a:Ga0209759_1004513); c00111_3300025.. (original name was: 3300025256.a:Ga0209759_1004922); c00112_3300025.. (original name was: 3300025256.a:Ga0209759_1003441); c00113_3300025.. (original name was: 3300025256.a:Ga0209759_1001396); c00114_3300025.. (original name was: 3300025256.a:Ga0209759_1006713); c00115_3300025.. (original name was: 3300025256.a:Ga0209759_1008409); c00116_3300025.. (original name was: 3300025256.a:Ga0209759_1004728); c00117_3300025.. (original name was: 3300025256.a:Ga0209759_1001422); c00118_3300025.. (original name was: 3300025256.a:Ga0209759_1003467); c00119_3300025.. (original name was: 3300025256.a:Ga0209759_1005258); c00120_3300025.. (original name was: 3300025256.a:Ga0209759_1001676); c00123_3300025.. (original name was: 3300025256.a:Ga0209759_1001987); c00124_3300025.. (original name was: 3300025256.a:Ga0209759_1001448); c00125_3300025.. (original name was: 3300025256.a:Ga0209759_1003902); c00126_3300025.. (original name was: 3300025256.a:Ga0209759_1001219); c00127_3300025.. (original name was: 3300025256.a:Ga0209759_1002092); c00128_3300025.. (original name was: 3300025256.a:Ga0209759_1001011); c00129_3300025.. (original name was: 3300025256.a:Ga0209759_1001829); c00130_3300025.. (original name was: 3300025256.a:Ga0209759_1000602); c00131_3300025.. (original name was: 3300025256.a:Ga0209759_1001022); c00132_3300025.. (original name was: 3300025256.a:Ga0209759_1000204); c00133_3300025.. (original name was: 3300025256.a:Ga0209759_1001143); c00134_3300025.. (original name was: 3300025256.a:Ga0209759_1002614); c00135_3300025.. (original name was: 3300025256.a:Ga0209759_1007113); c00136_3300025.. (original name was: 3300025256.a:Ga0209759_1002631); c00137_3300025.. (original name was: 3300025256.a:Ga0209759_1000243); c00138_3300025.. (original name was: 3300025256.a:Ga0209759_1001994); c00139_3300025.. (original name was: 3300025256.a:Ga0209759_1004402); c00140_3300025.. (original name was: 3300025256.a:Ga0209759_1001201); c00141_3300025.. (original name was: 3300025256.a:Ga0209759_1002559); c00142_3300025.. (original name was: 3300025256.a:Ga0209759_1001270); c00143_3300025.. (original name was: 3300025256.a:Ga0209759_1000353); c00144_3300025.. (original name was: 3300025256.a:Ga0209759_1000950); c00145_3300025.. (original name was: 3300025256.a:Ga0209759_1002060); c00146_3300025.. (original name was: 3300025256.a:Ga0209759_1000259); c00147_3300025.. (original name was: 3300025256.a:Ga0209759_1000287); c00148_3300025.. (original name was: 3300025256.a:Ga0209759_1001669); c00149_3300025.. (original name was: 3300025256.a:Ga0209759_1000442); c00150_3300025.. (original name was: 3300025256.a:Ga0209759_1002078); c00151_3300025.. (original name was: 3300025256.a:Ga0209759_1006212); c00152_3300025.. (original name was: 3300025256.a:Ga0209759_1000486); c00153_3300025.. (original name was: 3300025256.a:Ga0209759_1003140); c00154_3300025.. (original name was: 3300025256.a:Ga0209759_1000145); c00155_3300025.. (original name was: 3300025256.a:Ga0209759_1002660); c00156_3300025.. (original name was: 3300025256.a:Ga0209759_1001024); c00157_3300025.. (original name was: 3300025256.a:Ga0209759_1001884); c00158_3300025.. (original name was: 3300025256.a:Ga0209759_1000885); c00160_3300025.. (original name was: 3300025256.a:Ga0209759_1000299); c00161_3300025.. (original name was: 3300025256.a:Ga0209759_1001273); c00162_3300025.. (original name was: 3300025256.a:Ga0209759_1000411); c00163_3300025.. (original name was: 3300025256.a:Ga0209759_1002865); c00164_3300025.. (original name was: 3300025256.a:Ga0209759_1003561); c00165_3300025.. (original name was: 3300025256.a:Ga0209759_1001107); c00166_3300025.. (original name was: 3300025256.a:Ga0209759_1000709); c00167_3300025.. (original name was: 3300025256.a:Ga0209759_1002592); c00168_3300025.. (original name was: 3300025256.a:Ga0209759_1002183); c00169_3300025.. (original name was: 3300025256.a:Ga0209759_1004782); c00170_3300025.. (original name was: 3300025256.a:Ga0209759_1007645); c00171_3300025.. (original name was: 3300025256.a:Ga0209759_1000943); c00172_3300025.. (original name was: 3300025256.a:Ga0209759_1003132); c00173_3300025.. (original name was: 3300025256.a:Ga0209759_1003180); c00175_3300025.. (original name was: 3300025256.a:Ga0209759_1001135); c00176_3300025.. (original name was: 3300025256.a:Ga0209759_1000551); c00177_3300025.. (original name was: 3300025256.a:Ga0209759_1000960); c00178_3300025.. (original name was: 3300025256.a:Ga0209759_1004704); c00179_3300025.. (original name was: 3300025256.a:Ga0209759_1002672); c00180_3300025.. (original name was: 3300025256.a:Ga0209759_1002086); c00181_3300025.. (original name was: 3300025256.a:Ga0209759_1005093); c00183_3300025.. (original name was: 3300025256.a:Ga0209759_1001003); c00184_3300025.. (original name was: 3300025256.a:Ga0209759_1000710); c00185_3300025.. (original name was: 3300025256.a:Ga0209759_1001517); c00186_3300025.. (original name was: 3300025256.a:Ga0209759_1001108); c00187_3300025.. (original name was: 3300025256.a:Ga0209759_1001513); c00188_3300025.. (original name was: 3300025256.a:Ga0209759_1000286); c00189_3300025.. (original name was: 3300025256.a:Ga0209759_1005948); c00191_3300025.. (original name was: 3300025256.a:Ga0209759_1000794); c00192_3300025.. (original name was: 3300025256.a:Ga0209759_1001179); c00193_3300025.. (original name was: 3300025256.a:Ga0209759_1004451); c00194_3300025.. (original name was: 3300025256.a:Ga0209759_1000361); c00195_3300025.. (original name was: 3300025256.a:Ga0209759_1006905); c00196_3300025.. (original name was: 3300025256.a:Ga0209759_1000338); c00197_3300025.. (original name was: 3300025256.a:Ga0209759_1007877); c00198_3300025.. (original name was: 3300025256.a:Ga0209759_1001333); c00199_3300025.. (original name was: 3300025256.a:Ga0209759_1000841); c00200_3300025.. (original name was: 3300025256.a:Ga0209759_1009134); c00201_3300025.. (original name was: 3300025256.a:Ga0209759_1000136); c00202_3300025.. (original name was: 3300025256.a:Ga0209759_1003718); c00203_3300025.. (original name was: 3300025256.a:Ga0209759_1001537); c00204_3300025.. (original name was: 3300025256.a:Ga0209759_1000249); c00205_3300025.. (original name was: 3300025256.a:Ga0209759_1000658); c00206_3300025.. (original name was: 3300025256.a:Ga0209759_1000416); c00207_3300025.. (original name was: 3300025256.a:Ga0209759_1000536); c00208_3300025.. (original name was: 3300025256.a:Ga0209759_1000533); c00209_3300025.. (original name was: 3300025256.a:Ga0209759_1003060); c00210_3300025.. (original name was: 3300025256.a:Ga0209759_1000606); c00211_3300025.. (original name was: 3300025256.a:Ga0209759_1002895); c00212_3300025.. (original name was: 3300025256.a:Ga0209759_1004122); c00213_3300025.. (original name was: 3300025256.a:Ga0209759_1000982); c00215_3300025.. (original name was: 3300025256.a:Ga0209759_1002734); c00216_3300025.. (original name was: 3300025256.a:Ga0209759_1000689); c00217_3300025.. (original name was: 3300025256.a:Ga0209759_1002824); c00218_3300025.. (original name was: 3300025256.a:Ga0209759_1001597); c00219_3300025.. (original name was: 3300025256.a:Ga0209759_1000779); c00220_3300025.. (original name was: 3300025256.a:Ga0209759_1000777); c00221_3300025.. (original name was: 3300025256.a:Ga0209759_1001111); c00222_3300025.. (original name was: 3300025256.a:Ga0209759_1002292); c00224_3300025.. (original name was: 3300025256.a:Ga0209759_1001126); c00225_3300025.. (original name was: 3300025256.a:Ga0209759_1001462); c00226_3300025.. (original name was: 3300025256.a:Ga0209759_1002717); c00227_3300025.. (original name was: 3300025256.a:Ga0209759_1001899); c00228_3300025.. (original name was: 3300025256.a:Ga0209759_1001490); c00229_3300025.. (original name was: 3300025256.a:Ga0209759_1001081); c00230_3300025.. (original name was: 3300025256.a:Ga0209759_1002918); c00231_3300025.. (original name was: 3300025256.a:Ga0209759_1002100); c00232_3300025.. (original name was: 3300025256.a:Ga0209759_1001576); c00233_3300025.. (original name was: 3300025256.a:Ga0209759_1004139); c00234_3300025.. (original name was: 3300025256.a:Ga0209759_1001276); c00235_3300025.. (original name was: 3300025256.a:Ga0209759_1002503)

Compact view

c00032_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 26,247 nt. (total: 26,247 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26247:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_9

Search NORINE for peptide: strict or relaxed

AMP-binding (465..855): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DILwLGLVlK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

c00034_3300025.. - Region 1 - NRPS,arylpolyene

Download region GenBank file

Location: 1 - 76,396 nt. (total: 76,396 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 76396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 52163:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val) + (X) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_9

Search NORINE for peptide: strict or relaxed

AMP-binding (31..302): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gvMV-----K
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 30% (weak)

ctg34_21

Search NORINE for peptide: strict or relaxed

AMP-binding (499..903): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVaHVaK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

ctg34_22

Search NORINE for peptide: strict or relaxed

AMP-binding (485..891): X

NRPSPredictor2: tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: tyr, bht
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DvSviGAICK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 70% (weak)

ctg34_26

Search NORINE for peptide: strict or relaxed

AMP-binding (36..428): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DgFllGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 70% (weak)

c00121_3300025.. - Region 1 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 1 - 19,464 nt. (total: 19,464 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg121_1 - Putative Class II

ctg121_2 leader / core peptide: MQQHDDVVSGWLSGSDNFGGLDNPAGPLYLDNATEEKMTSQVG - AAIFDhbDhbQKDhbDhaQDhaCADhaGCICC
ctg121_3 leader / core peptide: MQQNDDVVSSWLNGTDSIGGLDNPAGPLYVDGATEKRMTSEAGA - QIMQDhbLLKDhbDhbQDhaCADhaGCACC
allorf_03421_03573 leader / core peptide: VLAEHSGDRRSVDAM - VRDhaHADMQGRRGLRRIKDhaEQDhbWCALFGDhbDFVRDIG

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg121_2 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1913.9 Da

Molecular weight: 1915.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1933.2 Da N = 1; 1951.3 Da N = 2

ctg121_3 - Class II

Cleavage pHMM score: -2.20

RODEO score: 0

Monoisotopic mass: 1998.9 Da

Molecular weight: 2000.4 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2018.4 Da N = 1

allorf_03421_03573 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 3989.1 Da

Molecular weight: 3991.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4009.5 Da N = 1; 4027.5 Da N = 2; 4045.6 Da N = 3

c00122_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 27,224 nt. (total: 27,224 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 27224:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg122_1

Search NORINE for peptide: strict or relaxed

AMP-binding (470..872): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1537..1942): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHlSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

c00159_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 7,462 nt. (total: 7,462 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 7462:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg159_1

Search NORINE for peptide: strict or relaxed

AMP-binding (611..1004): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gevFcGVpVK
Nearest Stachelhaus code:: pip
Stachelhaus code match:: 50% (weak)

c00174_3300025.. - Region 1 - T1PKS

Download region GenBank file

Location: 1 - 3,764 nt. (total: 3,764 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3764:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg174_1

PKS_AT (450..738): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 141.0
inactive: 77.7
Methoxymalonyl-CoA: 55.1
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 35.2
Benzoyl-CoA: 28.9
Acetyl-CoA: 26.1
CHC-CoA: 23.0
Isobutyryl-CoA: 22.2
Ethylmalonyl-CoA: 22.0
2-Methylbutyryl-CoA: 21.1
trans-1,2-CPDA: 18.5
fatty_acid: 13.6
3-Methylbutyryl-CoA: 9.7

c00182_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 15,492 - 38,646 nt. (total: 23,155 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00182_3300025.. - Region 2 - bacteriocin

Download region GenBank file

Location: 72,327 - 83,184 nt. (total: 10,858 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00190_3300025.. - Region 1 - terpene

Download region GenBank file

Location: 12,336 - 33,361 nt. (total: 21,026 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00214_3300025.. - Region 1 - arylpolyene

Download region GenBank file

Location: 29,502 - 76,811 nt. (total: 47,310 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00214_3300025.. - Region 2 - terpene

Download region GenBank file

Location: 96,656 - 117,519 nt. (total: 20,864 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00223_3300025.. - Region 1 - indole

Download region GenBank file

Location: 4,135 - 26,114 nt. (total: 21,980 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it