3300025295_47 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300025.. (original name was: 3300025295.a:Ga0209564_1000001)

Region	Type	From	To
Region 1	transAT-PKS,NRPS,T3PKS,PKS-like	168,159	327,290
Region 2	NRPS,lanthipeptide	543,552	619,187
Region 3	NRPS	655,567	699,428
Region 4	bacteriocin	1,062,315	1,071,782
Region 5	bacteriocin	1,412,216	1,423,100

c00001_3300025.. - Region 1 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Location: 168,159 - 327,290 nt. (total: 159,132 nt) Show pHMM detection rules used

transAT-PKS: (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 168158 - 327290:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal) + (gly - val - X - X) + (ccmal) + (mal) + (mal - mal) + (mal - ccmal) + (ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_156

PKS_AT (5..280): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.8
Methoxymalonyl-CoA: 44.0
inactive: 32.8
Propionyl-CoA: 32.4
Methylmalonyl-CoA: 29.5
2-Methylbutyryl-CoA: 23.1
Isobutyryl-CoA: 9.7
Acetyl-CoA: 9.7
CHC-CoA: 7.1
Ethylmalonyl-CoA: 6.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

PKS_AT (322..604): pk

minowa: inactive

Prediction, score:

inactive: 50.2
Malonyl-CoA: 48.4
Methoxymalonyl-CoA: 30.3
Methylmalonyl-CoA: 28.1
Benzoyl-CoA: 22.8
Isobutyryl-CoA: 18.8
Ethylmalonyl-CoA: 10.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.7

ATSignature: (unknown)

No matches above 50%

ctg1_157

Search NORINE for peptide: strict or relaxed

AMP-binding (284..687): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGvVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (1349..1760): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAwWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2437..2829): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAgALaGilK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (3483..3886): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALdVGEVtK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

ctg1_168

Search NORINE for peptide: strict or relaxed

AMP-binding (5..362): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtilK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg1_180

PKS_AT (4..286): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.4
Methoxymalonyl-CoA: 34.0
inactive: 28.1
Methylmalonyl-CoA: 19.2
Propionyl-CoA: 16.1
Isobutyryl-CoA: 9.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

ctg1_183

PKS_AT (8..297): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 29.4
inactive: 22.9
Methoxymalonyl-CoA: 9.7
Isobutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

c00001_3300025.. - Region 2 - NRPS,lanthipeptide

Download region GenBank file

Location: 543,552 - 619,187 nt. (total: 75,636 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_372 - Putative Class II

ctg1_369 leader / core peptide: MHRIKLIALGVLLAA - DhaADhaDhbGAADhbQDhaQGCFCDhaDhbIYYNDAGAVVGVRQPADhaCGDDhbGYGEVDhbKKYKVVAGCVM
ctg1_371 leader / core peptide: MQDNDLIKGWLTGSANVGGFDNPAGPLFLEGENAVEDAM - RAPIDhbHDhaDhbDhaVDhaDhbCPDhaGRCICCI
allorf_0561889_0562047 leader / core peptide: MRRRVARVYRDFPLENRVIRLRRGARRMVSYA - QRVAHRFAFVVQMMRDhbCWDhbP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

ctg1_369 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 5375.6 Da

Molecular weight: 5379.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 5397.0 Da N = 1; 5415.0 Da N = 2; 5433.0 Da N = 3; 5451.1 Da N = 4; 5469.1 Da N = 5; 5487.1 Da N = 6

ctg1_371 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 2165.1 Da

Molecular weight: 2166.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2184.6 Da N = 1; 2202.6 Da N = 2; 2220.6 Da N = 3

allorf_0561889_0562047 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 2427.2 Da

Molecular weight: 2428.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2446.9 Da N = 1

Predicted core structure(s)

For candidate cluster 2, location 543551 - 619187:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - leu - X - leu) + (leu - X - ile - thr - gly - asn - ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_373

Search NORINE for peptide: strict or relaxed

AMP-binding (32..425): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1110..1499): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2158..2558): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFTVAAiwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (3219..3621): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg1_374

Search NORINE for peptide: strict or relaxed

AMP-binding (517..914): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1574..1975): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAInK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (2663..3060): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFLGCTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (4171..4574): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5233..5628): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGmVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (6287..6701): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (7365..7775): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00001_3300025.. - Region 3 - NRPS

Download region GenBank file

Location: 655,567 - 699,428 nt. (total: 43,862 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00001_3300025.. - Region 4 - bacteriocin

Download region GenBank file

Location: 1,062,315 - 1,071,782 nt. (total: 9,468 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00001_3300025.. - Region 5 - bacteriocin

Download region GenBank file

Location: 1,412,216 - 1,423,100 nt. (total: 10,885 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it