3300025299_9 - 12 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00003_3300025.. (original name was: 3300025299.a:Ga0209256_1000021)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS	512,239	537,097

c00004_3300025.. (original name was: 3300025299.a:Ga0209256_1000002)

Region	Type	From	To
Region 4.1	bacteriocin	484,406	493,617
Region 4.2	bacteriocin	834,201	845,070
Region 4.3	NRPS	1,208,853	1,250,242
Region 4.4	NRPS,lanthipeptide	1,287,554	1,363,189
Region 4.5	transAT-PKS,PKS-like,T3PKS,NRPS	1,579,451	1,738,582

c00005_3300025.. (original name was: 3300025299.a:Ga0209256_1000048)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	1	26,095

c00006_3300025.. (original name was: 3300025299.a:Ga0209256_1000004)

Region	Type	From	To
Region 6.1	lanthipeptide	383,750	405,673
Region 6.2	NRPS	529,664	573,683
Region 6.3	arylpolyene	604,791	646,011
Region 6.4	lipolanthine,lanthipeptide	1,381,837	1,420,492

c00007_3300025.. (original name was: 3300025299.a:Ga0209256_1000815)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	NRPS	1	39,837

Region	Type	From	To	Similarity
Region 3.1	NRPS	512,239	537,097
Region 4.1	bacteriocin	484,406	493,617
Region 4.2	bacteriocin	834,201	845,070
Region 4.3	NRPS	1,208,853	1,250,242
Region 4.4	NRPS,lanthipeptide	1,287,554	1,363,189
Region 4.5	transAT-PKS,PKS-like,T3PKS,NRPS	1,579,451	1,738,582
Region 5.1	NRPS	1	26,095
Region 6.1	lanthipeptide	383,750	405,673
Region 6.2	NRPS	529,664	573,683
Region 6.3	arylpolyene	604,791	646,011
Region 6.4	lipolanthine,lanthipeptide	1,381,837	1,420,492
Region 7.1	NRPS	1	39,837

No secondary metabolite regions were found in these records:: c00001_3300025.. (original name was: 3300025299.a:Ga0209256_1000006); c00002_3300025.. (original name was: 3300025299.a:Ga0209256_1000031)

Compact view

c00003_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 512,239 - 537,097 nt. (total: 24,859 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 512238 - 537097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg3_476

Search NORINE for peptide: strict or relaxed

AMP-binding (757..1156): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

c00004_3300025.. - Region 1 - bacteriocin

Download region GenBank file

Location: 484,406 - 493,617 nt. (total: 9,212 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00004_3300025.. - Region 2 - bacteriocin

Download region GenBank file

Location: 834,201 - 845,070 nt. (total: 10,870 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00004_3300025.. - Region 3 - NRPS

Download region GenBank file

Location: 1,208,853 - 1,250,242 nt. (total: 41,390 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00004_3300025.. - Region 4 - NRPS,lanthipeptide

Download region GenBank file

Location: 1,287,554 - 1,363,189 nt. (total: 75,636 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Lanthipeptides

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_1085 - Putative Class II

ctg4_1086 leader / core peptide: MQDNDLIKGWLTGSANVGGFDNPAGPLFLEGENAVEDAM - RAPIDhbHDhaDhbDhaVDhaDhbCPDhaGRCICCI
ctg4_1088 leader / core peptide: MHRIKLIALGVLLAA - DhaADhaDhbGAADhbQDhaQGCFCDhaDhbIYYNDAGAVVGVRQPADhaCGDDhbGYGEVDhbKKYKVVAGCVM
allorf_1344694_1344852 leader / core peptide: MRRRVARVYRDFPLENRVIRLRRGARRMVSYA - QRVAHRFAFVVQMMRDhbCWDhbP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

NRPS/PKS products

NRPS/PKS monomers

Core peptide predictions

ctg4_1086 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 2165.1 Da

Molecular weight: 2166.5 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2184.6 Da N = 1; 2202.6 Da N = 2; 2220.6 Da N = 3

ctg4_1088 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 5375.6 Da

Molecular weight: 5379.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 5397.0 Da N = 1; 5415.0 Da N = 2; 5433.0 Da N = 3; 5451.1 Da N = 4; 5469.1 Da N = 5; 5487.1 Da N = 6

allorf_1344694_1344852 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 2427.2 Da

Molecular weight: 2428.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2446.9 Da N = 1

Predicted core structure(s)

For candidate cluster 4, location 1287553 - 1363189:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (leu - X - ile - thr - gly - asn - ser) + (leu - leu - X - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_1083

Search NORINE for peptide: strict or relaxed

AMP-binding (517..914): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1574..1975): X

NRPSPredictor2: orn, lys, arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAInK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (2663..3060): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAMFLGCTYK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

AMP-binding (4171..4574): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5233..5628): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGmVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (6287..6701): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (7365..7775): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg4_1084

Search NORINE for peptide: strict or relaxed

AMP-binding (32..425): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1110..1499): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2158..2558): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFTVAAiwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (3219..3621): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

c00004_3300025.. - Region 5 - NRPS,PKS-like,T3PKS,transAT-PKS

Download region GenBank file

Location: 1,579,451 - 1,738,582 nt. (total: 159,132 nt) Show pHMM detection rules used

transAT-PKS: (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)))
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 6, location 1579450 - 1738582:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal) + (gly - val - X - X) + (ccmal) + (mal) + (mal - mal) + (mal - ccmal) + (ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_1274

PKS_AT (8..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 29.4
inactive: 22.9
Methoxymalonyl-CoA: 9.7
Isobutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_1277

PKS_AT (4..286): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.4
Methoxymalonyl-CoA: 34.0
inactive: 28.1
Methylmalonyl-CoA: 19.2
Propionyl-CoA: 16.1
Isobutyryl-CoA: 9.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg4_1289

Search NORINE for peptide: strict or relaxed

AMP-binding (5..362): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtilK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg4_1300

Search NORINE for peptide: strict or relaxed

AMP-binding (284..687): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGvVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

AMP-binding (1349..1760): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAwWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (2437..2829): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAgALaGilK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 60% (weak)

AMP-binding (3483..3886): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALdVGEVtK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

ctg4_1301

PKS_AT (5..280): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.8
Methoxymalonyl-CoA: 44.0
inactive: 32.8
Propionyl-CoA: 32.4
Methylmalonyl-CoA: 29.5
2-Methylbutyryl-CoA: 23.1
Isobutyryl-CoA: 9.7
Acetyl-CoA: 9.7
CHC-CoA: 7.1
Ethylmalonyl-CoA: 6.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (322..604): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 50.2
Malonyl-CoA: 48.4
Methoxymalonyl-CoA: 30.3
Methylmalonyl-CoA: 28.1
Benzoyl-CoA: 22.8
Isobutyryl-CoA: 18.8
Ethylmalonyl-CoA: 10.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.7

c00005_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 26,095 nt. (total: 26,095 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00006_3300025.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 383,750 - 405,673 nt. (total: 21,924 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00006_3300025.. - Region 2 - NRPS

Download region GenBank file

Location: 529,664 - 573,683 nt. (total: 44,020 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 529663 - 573683:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg6_460

Search NORINE for peptide: strict or relaxed

AMP-binding (462..860): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLVWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

c00006_3300025.. - Region 3 - arylpolyene

Download region GenBank file

Location: 604,791 - 646,011 nt. (total: 41,221 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00006_3300025.. - Region 4 - lanthipeptide,lipolanthine

Download region GenBank file

Location: 1,381,837 - 1,420,492 nt. (total: 38,656 nt) Show pHMM detection rules used

lipolanthine: (micKC and Flavoprotein)
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Lanthipeptides

Core peptide predictions

No core peptides found.

c00007_3300025.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 39,837 nt. (total: 39,837 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 39837:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (asp - asp) + (asn) + (thr - asp) + (pro - val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_1

Search NORINE for peptide: strict or relaxed

AMP-binding (518..926): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAHVcK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

AMP-binding (1589..1995): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAwWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg7_2

Search NORINE for peptide: strict or relaxed

AMP-binding (563..973): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1660..2060): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DMKDLGMVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg7_3

Search NORINE for peptide: strict or relaxed

AMP-binding (516..926): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DATKVGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg7_4

Search NORINE for peptide: strict or relaxed

AMP-binding (515..915): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DMKDLGMVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (1603..2003): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DMKDLGMVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg7_5

Search NORINE for peptide: strict or relaxed

AMP-binding (526..924): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAkNAGidiK
Nearest Stachelhaus code:: dpg
Stachelhaus code match:: 60% (weak)

AMP-binding (1956..2359): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DsvDvGtVyK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 50% (weak)

AMP-binding (3019..3422): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)