3300026797_1 - 6 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00004_3300026.. (original name was: 3300026797.a:Ga0209911_100118)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	lanthipeptide,bacteriocin	35,377	55,156

c00005_3300026.. (original name was: 3300026797.a:Ga0209911_100091)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS,T1PKS	1	85,218

c00007_3300026.. (original name was: 3300026797.a:Ga0209911_100065)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	hglE-KS,T1PKS	60,937	111,745

c00041_3300026.. (original name was: 3300026797.a:Ga0209911_100040)

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	lassopeptide	121,114	143,443

c00045_3300026.. (original name was: 3300026797.a:Ga0209911_100047)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	terpene	108,917	129,819

c00052_3300026.. (original name was: 3300026797.a:Ga0209911_100163)

Region	Type	From	To	Most similar known cluster		Similarity
Region 52.1	microviridin	6,198	20,406

Region	Type	From	To	Similarity
Region 4.1	lanthipeptide,bacteriocin	35,377	55,156
Region 5.1	NRPS,T1PKS	1	85,218
Region 7.1	hglE-KS,T1PKS	60,937	111,745
Region 41.1	lassopeptide	121,114	143,443
Region 45.1	terpene	108,917	129,819
Region 52.1	microviridin	6,198	20,406

No secondary metabolite regions were found in these records:: c00001_3300026.. (original name was: 3300026797.a:Ga0209911_100369); c00002_3300026.. (original name was: 3300026797.a:Ga0209911_100344); c00003_3300026.. (original name was: 3300026797.a:Ga0209911_100126); c00006_3300026.. (original name was: 3300026797.a:Ga0209911_100082); c00008_3300026.. (original name was: 3300026797.a:Ga0209911_100220); c00009_3300026.. (original name was: 3300026797.a:Ga0209911_100079); c00010_3300026.. (original name was: 3300026797.a:Ga0209911_100130); c00011_3300026.. (original name was: 3300026797.a:Ga0209911_100033); c00012_3300026.. (original name was: 3300026797.a:Ga0209911_100074); c00013_3300026.. (original name was: 3300026797.a:Ga0209911_100027); c00014_3300026.. (original name was: 3300026797.a:Ga0209911_100049); c00015_3300026.. (original name was: 3300026797.a:Ga0209911_100143); c00016_3300026.. (original name was: 3300026797.a:Ga0209911_100041); c00017_3300026.. (original name was: 3300026797.a:Ga0209911_100087); c00018_3300026.. (original name was: 3300026797.a:Ga0209911_100048); c00019_3300026.. (original name was: 3300026797.a:Ga0209911_100189); c00020_3300026.. (original name was: 3300026797.a:Ga0209911_100045); c00021_3300026.. (original name was: 3300026797.a:Ga0209911_100172); c00022_3300026.. (original name was: 3300026797.a:Ga0209911_100075); c00023_3300026.. (original name was: 3300026797.a:Ga0209911_100125); c00024_3300026.. (original name was: 3300026797.a:Ga0209911_100028); c00025_3300026.. (original name was: 3300026797.a:Ga0209911_100006); c00026_3300026.. (original name was: 3300026797.a:Ga0209911_100044); c00027_3300026.. (original name was: 3300026797.a:Ga0209911_100088); c00028_3300026.. (original name was: 3300026797.a:Ga0209911_100185); c00029_3300026.. (original name was: 3300026797.a:Ga0209911_100070); c00030_3300026.. (original name was: 3300026797.a:Ga0209911_100032); c00031_3300026.. (original name was: 3300026797.a:Ga0209911_100129); c00032_3300026.. (original name was: 3300026797.a:Ga0209911_100135); c00033_3300026.. (original name was: 3300026797.a:Ga0209911_100038); c00034_3300026.. (original name was: 3300026797.a:Ga0209911_100085); c00035_3300026.. (original name was: 3300026797.a:Ga0209911_100061); c00036_3300026.. (original name was: 3300026797.a:Ga0209911_100155); c00037_3300026.. (original name was: 3300026797.a:Ga0209911_100107); c00038_3300026.. (original name was: 3300026797.a:Ga0209911_100071); c00039_3300026.. (original name was: 3300026797.a:Ga0209911_100165); c00040_3300026.. (original name was: 3300026797.a:Ga0209911_100090); c00042_3300026.. (original name was: 3300026797.a:Ga0209911_100137); c00043_3300026.. (original name was: 3300026797.a:Ga0209911_100161); c00044_3300026.. (original name was: 3300026797.a:Ga0209911_100144); c00046_3300026.. (original name was: 3300026797.a:Ga0209911_100094); c00047_3300026.. (original name was: 3300026797.a:Ga0209911_100106); c00048_3300026.. (original name was: 3300026797.a:Ga0209911_100153); c00049_3300026.. (original name was: 3300026797.a:Ga0209911_100076); c00050_3300026.. (original name was: 3300026797.a:Ga0209911_100089); c00051_3300026.. (original name was: 3300026797.a:Ga0209911_100160); c00053_3300026.. (original name was: 3300026797.a:Ga0209911_100066); c00054_3300026.. (original name was: 3300026797.a:Ga0209911_100169); c00055_3300026.. (original name was: 3300026797.a:Ga0209911_100072); c00056_3300026.. (original name was: 3300026797.a:Ga0209911_100093); c00057_3300026.. (original name was: 3300026797.a:Ga0209911_100098); c00058_3300026.. (original name was: 3300026797.a:Ga0209911_100108); c00059_3300026.. (original name was: 3300026797.a:Ga0209911_100011)

Compact view

c00004_3300026.. - Region 1 - bacteriocin,lanthipeptide

Download region GenBank file

Location: 35,377 - 55,156 nt. (total: 19,780 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg4_44 - Putative Class II

ctg4_48 leader / core peptide: LLNSGYYGRIAPHEVDHVIAEKHGGLTEPDNLALS - CDhbLCNKHKGDhaDLDhbDhaIDPEDhbGDIVPLYHPRKD
allorf_37023_37160 leader / core peptide: VGIGKRQEARGKSFTPIFFRFWNEYQLQIQGM - DhbRVIPQIDhaCDhbFDhaE
allorf_40166_40291 leader / core peptide: LLLVRRSRNKATIYKKSKLEKTVFM - DhbFYFRRDhaCDhbDhaYVQDhaKH
allorf_43269_43349 leader / core peptide: LPAFLTSDAISGA - ICRRHKDhbIDhbQDhbFI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg4_48 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 3361.7 Da

Molecular weight: 3363.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3381.8 Da N = 1; 3399.8 Da N = 2; 3417.8 Da N = 3

allorf_37023_37160 - Class II

Cleavage pHMM score: -4.20

RODEO score: 0

Monoisotopic mass: 1407.7 Da

Molecular weight: 1408.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1426.6 Da N = 1; 1444.6 Da N = 2; 1462.7 Da N = 3

allorf_40166_40291 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1919.0 Da

Molecular weight: 1920.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1938.2 Da N = 1; 1956.2 Da N = 2; 1974.2 Da N = 3; 1992.2 Da N = 4

allorf_43269_43349 - Class II

Cleavage pHMM score: -4.10

RODEO score: 0

Monoisotopic mass: 1561.9 Da

Molecular weight: 1562.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1580.9 Da N = 1; 1598.9 Da N = 2

c00005_3300026.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 85,218 nt. (total: 85,218 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 85218:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - thr) + (asn - orn) + (ser) + (ohmal) + (asn) + (orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_10

Search NORINE for peptide: strict or relaxed

AMP-binding (470..873): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg5_25

CAL_domain (41..482): pk

minowa: NH2

Prediction, score:

NH2: 20.4
fatty_acid: 17.2
AHBA: 17.0
Acetyl-CoA: 0.9
shikimic_acid: 0.0

ctg5_28

Search NORINE for peptide: strict or relaxed

AMP-binding (463..871): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1533..1938): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg5_29

Search NORINE for peptide: strict or relaxed

AMP-binding (457..857): asn

NRPSPredictor2: asn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

AMP-binding (1518..1922): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

ctg5_30

Search NORINE for peptide: strict or relaxed

AMP-binding (539..939): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg5_31

PKS_AT (535..818): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.1
inactive: 119.8
Methoxymalonyl-CoA: 59.7
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 41.3
Propionyl-CoA: 37.2
Ethylmalonyl-CoA: 26.9
Benzoyl-CoA: 24.2
2-Methylbutyryl-CoA: 21.2
Acetyl-CoA: 19.0
CHC-CoA: 16.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

ctg5_34

Search NORINE for peptide: strict or relaxed

AMP-binding (465..866): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg5_35

Search NORINE for peptide: strict or relaxed

AMP-binding (507..916): orn

NRPSPredictor2: orn

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00007_3300026.. - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Location: 60,937 - 111,745 nt. (total: 50,809 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 60936 - 111745:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_84

PKS_AT (1054..1370): pk

minowa: Isobutyryl-CoA

Prediction, score:

Isobutyryl-CoA: 18.5
Benzoyl-CoA: 9.2
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

ctg7_87

PKS_AT (626..924): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.6
Methoxymalonyl-CoA: 42.3
Methylmalonyl-CoA: 29.2
CHC-CoA: 18.9
inactive: 14.2
fatty_acid: 13.3
Propionyl-CoA: 12.1
Isobutyryl-CoA: 10.4
trans-1,2-CPDA: 10.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

c00041_3300026.. - Region 1 - lassopeptide

Download region GenBank file

Location: 121,114 - 143,443 nt. (total: 22,330 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.