3300027514_1 - 23 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00003_3300027.. (original name was: 3300027514.a:Ga0208338_1000196)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	NRPS	1	4,759

c00014_3300027.. (original name was: 3300027514.a:Ga0208338_1000061)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	NRPS-like	13,987	47,966

c00032_3300027.. (original name was: 3300027514.a:Ga0208338_1000210)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	NRPS	1	3,468

c00034_3300027.. (original name was: 3300027514.a:Ga0208338_1000024)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	T1PKS,NRPS	1,468	71,146

c00035_3300027.. (original name was: 3300027514.a:Ga0208338_1000149)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	1	13,531

c00038_3300027.. (original name was: 3300027514.a:Ga0208338_1000005)

Region	Type	From	To	Most similar known cluster		Similarity
Region 38.1	lassopeptide	77,792	100,549

c00040_3300027.. (original name was: 3300027514.a:Ga0208338_1000030)

Region	Type	From	To	Most similar known cluster		Similarity
Region 40.1	NRPS,T1PKS	28,126	66,976

c00072_3300027.. (original name was: 3300027514.a:Ga0208338_1000096)

Region	Type	From	To	Most similar known cluster		Similarity
Region 72.1	lassopeptide	13,151	26,507

c00081_3300027.. (original name was: 3300027514.a:Ga0208338_1000150)

Region	Type	From	To	Most similar known cluster		Similarity
Region 81.1	NRPS	1	13,498

c00082_3300027.. (original name was: 3300027514.a:Ga0208338_1000071)

Region	Type	From	To	Most similar known cluster		Similarity
Region 82.1	NRPS	1	38,358

c00085_3300027.. (original name was: 3300027514.a:Ga0208338_1000190)

Region	Type	From	To	Most similar known cluster		Similarity
Region 85.1	NRPS	1	5,416

c00086_3300027.. (original name was: 3300027514.a:Ga0208338_1000173)

Region	Type	From	To	Most similar known cluster		Similarity
Region 86.1	NRPS	1	8,006

c00095_3300027.. (original name was: 3300027514.a:Ga0208338_1000010)

Region	Type	From	To	Most similar known cluster		Similarity
Region 95.1	microviridin	86,353	103,680

c00103_3300027.. (original name was: 3300027514.a:Ga0208338_1000110)

Region	Type	From	To	Most similar known cluster		Similarity
Region 103.1	arylpolyene	1	22,603

c00104_3300027.. (original name was: 3300027514.a:Ga0208338_1000007)

Region	Type	From	To	Most similar known cluster		Similarity
Region 104.1	NRPS,bacteriocin,T1PKS	1	115,218

c00109_3300027.. (original name was: 3300027514.a:Ga0208338_1000053)

Region	Type	From	To	Most similar known cluster		Similarity
Region 109.1	NRPS	7,480	55,539

c00126_3300027.. (original name was: 3300027514.a:Ga0208338_1000046)

Region	Type	From	To	Most similar known cluster		Similarity
Region 126.1	bacteriocin	436	12,274

c00129_3300027.. (original name was: 3300027514.a:Ga0208338_1000014)

Region	Type	From	To	Most similar known cluster		Similarity
Region 129.1	NRPS	1	24,750

c00136_3300027.. (original name was: 3300027514.a:Ga0208338_1000003)

Region	Type	From	To	Most similar known cluster		Similarity
Region 136.1	NRPS-like	9,427	53,821

c00146_3300027.. (original name was: 3300027514.a:Ga0208338_1000075)

Region	Type	From	To	Most similar known cluster		Similarity
Region 146.1	T3PKS	1	32,703

c00152_3300027.. (original name was: 3300027514.a:Ga0208338_1000057)

Region	Type	From	To	Most similar known cluster		Similarity
Region 152.1	NRPS	1	52,517

c00161_3300027.. (original name was: 3300027514.a:Ga0208338_1000093)

Region	Type	From	To	Most similar known cluster		Similarity
Region 161.1	NRPS-like	1	26,767

c00186_3300027.. (original name was: 3300027514.a:Ga0208338_1000127)

Region	Type	From	To	Most similar known cluster		Similarity
Region 186.1	NRPS	1	19,202

Region	Type	From	To	Similarity
Region 3.1	NRPS	1	4,759
Region 14.1	NRPS-like	13,987	47,966
Region 32.1	NRPS	1	3,468
Region 34.1	T1PKS,NRPS	1,468	71,146
Region 35.1	NRPS	1	13,531
Region 38.1	lassopeptide	77,792	100,549
Region 40.1	NRPS,T1PKS	28,126	66,976
Region 72.1	lassopeptide	13,151	26,507
Region 81.1	NRPS	1	13,498
Region 82.1	NRPS	1	38,358
Region 85.1	NRPS	1	5,416
Region 86.1	NRPS	1	8,006
Region 95.1	microviridin	86,353	103,680
Region 103.1	arylpolyene	1	22,603
Region 104.1	NRPS,bacteriocin,T1PKS	1	115,218
Region 109.1	NRPS	7,480	55,539
Region 126.1	bacteriocin	436	12,274
Region 129.1	NRPS	1	24,750
Region 136.1	NRPS-like	9,427	53,821
Region 146.1	T3PKS	1	32,703
Region 152.1	NRPS	1	52,517
Region 161.1	NRPS-like	1	26,767
Region 186.1	NRPS	1	19,202

No secondary metabolite regions were found in these records:: c00001_3300027.. (original name was: 3300027514.a:Ga0208338_1000200); c00002_3300027.. (original name was: 3300027514.a:Ga0208338_1000198); c00004_3300027.. (original name was: 3300027514.a:Ga0208338_1000194); c00005_3300027.. (original name was: 3300027514.a:Ga0208338_1000185); c00006_3300027.. (original name was: 3300027514.a:Ga0208338_1000183); c00007_3300027.. (original name was: 3300027514.a:Ga0208338_1000179); c00008_3300027.. (original name was: 3300027514.a:Ga0208338_1000174); c00009_3300027.. (original name was: 3300027514.a:Ga0208338_1000153); c00010_3300027.. (original name was: 3300027514.a:Ga0208338_1000121); c00011_3300027.. (original name was: 3300027514.a:Ga0208338_1000056); c00012_3300027.. (original name was: 3300027514.a:Ga0208338_1000068); c00013_3300027.. (original name was: 3300027514.a:Ga0208338_1000159); c00015_3300027.. (original name was: 3300027514.a:Ga0208338_1000122); c00016_3300027.. (original name was: 3300027514.a:Ga0208338_1000154); c00017_3300027.. (original name was: 3300027514.a:Ga0208338_1000098); c00018_3300027.. (original name was: 3300027514.a:Ga0208338_1000144); c00019_3300027.. (original name was: 3300027514.a:Ga0208338_1000026); c00020_3300027.. (original name was: 3300027514.a:Ga0208338_1000020); c00021_3300027.. (original name was: 3300027514.a:Ga0208338_1000117); c00022_3300027.. (original name was: 3300027514.a:Ga0208338_1000148); c00023_3300027.. (original name was: 3300027514.a:Ga0208338_1000100); c00024_3300027.. (original name was: 3300027514.a:Ga0208338_1000133); c00025_3300027.. (original name was: 3300027514.a:Ga0208338_1000118); c00026_3300027.. (original name was: 3300027514.a:Ga0208338_1000130); c00027_3300027.. (original name was: 3300027514.a:Ga0208338_1000066); c00028_3300027.. (original name was: 3300027514.a:Ga0208338_1000131); c00029_3300027.. (original name was: 3300027514.a:Ga0208338_1000078); c00030_3300027.. (original name was: 3300027514.a:Ga0208338_1000128); c00031_3300027.. (original name was: 3300027514.a:Ga0208338_1000031); c00033_3300027.. (original name was: 3300027514.a:Ga0208338_1000011); c00036_3300027.. (original name was: 3300027514.a:Ga0208338_1000052); c00037_3300027.. (original name was: 3300027514.a:Ga0208338_1000204); c00039_3300027.. (original name was: 3300027514.a:Ga0208338_1000099); c00041_3300027.. (original name was: 3300027514.a:Ga0208338_1000045); c00042_3300027.. (original name was: 3300027514.a:Ga0208338_1000092); c00043_3300027.. (original name was: 3300027514.a:Ga0208338_1000044); c00044_3300027.. (original name was: 3300027514.a:Ga0208338_1000091); c00045_3300027.. (original name was: 3300027514.a:Ga0208338_1000134); c00046_3300027.. (original name was: 3300027514.a:Ga0208338_1000037); c00047_3300027.. (original name was: 3300027514.a:Ga0208338_1000084); c00048_3300027.. (original name was: 3300027514.a:Ga0208338_1000042); c00049_3300027.. (original name was: 3300027514.a:Ga0208338_1000089); c00050_3300027.. (original name was: 3300027514.a:Ga0208338_1000116); c00051_3300027.. (original name was: 3300027514.a:Ga0208338_1000019); c00052_3300027.. (original name was: 3300027514.a:Ga0208338_1000017); c00053_3300027.. (original name was: 3300027514.a:Ga0208338_1000132); c00054_3300027.. (original name was: 3300027514.a:Ga0208338_1000035); c00055_3300027.. (original name was: 3300027514.a:Ga0208338_1000012); c00056_3300027.. (original name was: 3300027514.a:Ga0208338_1000156); c00057_3300027.. (original name was: 3300027514.a:Ga0208338_1000059); c00058_3300027.. (original name was: 3300027514.a:Ga0208338_1000039); c00059_3300027.. (original name was: 3300027514.a:Ga0208338_1000113); c00060_3300027.. (original name was: 3300027514.a:Ga0208338_1000016); c00061_3300027.. (original name was: 3300027514.a:Ga0208338_1000027); c00062_3300027.. (original name was: 3300027514.a:Ga0208338_1000013); c00063_3300027.. (original name was: 3300027514.a:Ga0208338_1000041); c00064_3300027.. (original name was: 3300027514.a:Ga0208338_1000088); c00065_3300027.. (original name was: 3300027514.a:Ga0208338_1000135); c00066_3300027.. (original name was: 3300027514.a:Ga0208338_1000129); c00067_3300027.. (original name was: 3300027514.a:Ga0208338_1000032); c00068_3300027.. (original name was: 3300027514.a:Ga0208338_1000079); c00069_3300027.. (original name was: 3300027514.a:Ga0208338_1000022); c00070_3300027.. (original name was: 3300027514.a:Ga0208338_1000067); c00071_3300027.. (original name was: 3300027514.a:Ga0208338_1000080); c00073_3300027.. (original name was: 3300027514.a:Ga0208338_1000111); c00074_3300027.. (original name was: 3300027514.a:Ga0208338_1000048); c00075_3300027.. (original name was: 3300027514.a:Ga0208338_1000178); c00076_3300027.. (original name was: 3300027514.a:Ga0208338_1000081); c00077_3300027.. (original name was: 3300027514.a:Ga0208338_1000015); c00078_3300027.. (original name was: 3300027514.a:Ga0208338_1000112); c00079_3300027.. (original name was: 3300027514.a:Ga0208338_1000101); c00080_3300027.. (original name was: 3300027514.a:Ga0208338_1000167); c00083_3300027.. (original name was: 3300027514.a:Ga0208338_1000164); c00084_3300027.. (original name was: 3300027514.a:Ga0208338_1000197); c00087_3300027.. (original name was: 3300027514.a:Ga0208338_1000189); c00088_3300027.. (original name was: 3300027514.a:Ga0208338_1000169); c00089_3300027.. (original name was: 3300027514.a:Ga0208338_1000029); c00090_3300027.. (original name was: 3300027514.a:Ga0208338_1000126); c00091_3300027.. (original name was: 3300027514.a:Ga0208338_1000076); c00092_3300027.. (original name was: 3300027514.a:Ga0208338_1000058); c00093_3300027.. (original name was: 3300027514.a:Ga0208338_1000155); c00094_3300027.. (original name was: 3300027514.a:Ga0208338_1000021); c00096_3300027.. (original name was: 3300027514.a:Ga0208338_1000209); c00097_3300027.. (original name was: 3300027514.a:Ga0208338_1000009); c00098_3300027.. (original name was: 3300027514.a:Ga0208338_1000106); c00099_3300027.. (original name was: 3300027514.a:Ga0208338_1000004); c00100_3300027.. (original name was: 3300027514.a:Ga0208338_1000203); c00101_3300027.. (original name was: 3300027514.a:Ga0208338_1000008); c00102_3300027.. (original name was: 3300027514.a:Ga0208338_1000207); c00105_3300027.. (original name was: 3300027514.a:Ga0208338_1000104); c00106_3300027.. (original name was: 3300027514.a:Ga0208338_1000036); c00107_3300027.. (original name was: 3300027514.a:Ga0208338_1000033); c00108_3300027.. (original name was: 3300027514.a:Ga0208338_1000034); c00110_3300027.. (original name was: 3300027514.a:Ga0208338_1000006); c00111_3300027.. (original name was: 3300027514.a:Ga0208338_1000103); c00112_3300027.. (original name was: 3300027514.a:Ga0208338_1000147); c00113_3300027.. (original name was: 3300027514.a:Ga0208338_1000050); c00114_3300027.. (original name was: 3300027514.a:Ga0208338_1000023); c00115_3300027.. (original name was: 3300027514.a:Ga0208338_1000120); c00116_3300027.. (original name was: 3300027514.a:Ga0208338_1000070); c00117_3300027.. (original name was: 3300027514.a:Ga0208338_1000047); c00118_3300027.. (original name was: 3300027514.a:Ga0208338_1000055); c00119_3300027.. (original name was: 3300027514.a:Ga0208338_1000152); c00120_3300027.. (original name was: 3300027514.a:Ga0208338_1000018); c00121_3300027.. (original name was: 3300027514.a:Ga0208338_1000115); c00122_3300027.. (original name was: 3300027514.a:Ga0208338_1000065); c00123_3300027.. (original name was: 3300027514.a:Ga0208338_1000162); c00124_3300027.. (original name was: 3300027514.a:Ga0208338_1000069); c00125_3300027.. (original name was: 3300027514.a:Ga0208338_1000166); c00127_3300027.. (original name was: 3300027514.a:Ga0208338_1000143); c00128_3300027.. (original name was: 3300027514.a:Ga0208338_1000025); c00130_3300027.. (original name was: 3300027514.a:Ga0208338_1000213); c00131_3300027.. (original name was: 3300027514.a:Ga0208338_1000072); c00132_3300027.. (original name was: 3300027514.a:Ga0208338_1000201); c00133_3300027.. (original name was: 3300027514.a:Ga0208338_1000002); c00134_3300027.. (original name was: 3300027514.a:Ga0208338_1000049); c00135_3300027.. (original name was: 3300027514.a:Ga0208338_1000073); c00137_3300027.. (original name was: 3300027514.a:Ga0208338_1000063); c00138_3300027.. (original name was: 3300027514.a:Ga0208338_1000040); c00139_3300027.. (original name was: 3300027514.a:Ga0208338_1000137); c00140_3300027.. (original name was: 3300027514.a:Ga0208338_1000074); c00141_3300027.. (original name was: 3300027514.a:Ga0208338_1000171); c00142_3300027.. (original name was: 3300027514.a:Ga0208338_1000051); c00143_3300027.. (original name was: 3300027514.a:Ga0208338_1000064); c00144_3300027.. (original name was: 3300027514.a:Ga0208338_1000161); c00145_3300027.. (original name was: 3300027514.a:Ga0208338_1000028); c00147_3300027.. (original name was: 3300027514.a:Ga0208338_1000172); c00148_3300027.. (original name was: 3300027514.a:Ga0208338_1000054); c00149_3300027.. (original name was: 3300027514.a:Ga0208338_1000151); c00150_3300027.. (original name was: 3300027514.a:Ga0208338_1000043); c00151_3300027.. (original name was: 3300027514.a:Ga0208338_1000140); c00153_3300027.. (original name was: 3300027514.a:Ga0208338_1000182); c00154_3300027.. (original name was: 3300027514.a:Ga0208338_1000085); c00155_3300027.. (original name was: 3300027514.a:Ga0208338_1000038); c00156_3300027.. (original name was: 3300027514.a:Ga0208338_1000062); c00157_3300027.. (original name was: 3300027514.a:Ga0208338_1000082); c00158_3300027.. (original name was: 3300027514.a:Ga0208338_1000083); c00159_3300027.. (original name was: 3300027514.a:Ga0208338_1000180); c00160_3300027.. (original name was: 3300027514.a:Ga0208338_1000086); c00162_3300027.. (original name was: 3300027514.a:Ga0208338_1000094); c00163_3300027.. (original name was: 3300027514.a:Ga0208338_1000191); c00164_3300027.. (original name was: 3300027514.a:Ga0208338_1000095); c00165_3300027.. (original name was: 3300027514.a:Ga0208338_1000192); c00166_3300027.. (original name was: 3300027514.a:Ga0208338_1000097); c00167_3300027.. (original name was: 3300027514.a:Ga0208338_1000090); c00168_3300027.. (original name was: 3300027514.a:Ga0208338_1000158); c00169_3300027.. (original name was: 3300027514.a:Ga0208338_1000102); c00170_3300027.. (original name was: 3300027514.a:Ga0208338_1000168); c00171_3300027.. (original name was: 3300027514.a:Ga0208338_1000176); c00172_3300027.. (original name was: 3300027514.a:Ga0208338_1000105); c00173_3300027.. (original name was: 3300027514.a:Ga0208338_1000107); c00174_3300027.. (original name was: 3300027514.a:Ga0208338_1000108); c00175_3300027.. (original name was: 3300027514.a:Ga0208338_1000109); c00176_3300027.. (original name was: 3300027514.a:Ga0208338_1000114); c00177_3300027.. (original name was: 3300027514.a:Ga0208338_1000119); c00178_3300027.. (original name was: 3300027514.a:Ga0208338_1000123); c00179_3300027.. (original name was: 3300027514.a:Ga0208338_1000124); c00180_3300027.. (original name was: 3300027514.a:Ga0208338_1000136); c00181_3300027.. (original name was: 3300027514.a:Ga0208338_1000138); c00182_3300027.. (original name was: 3300027514.a:Ga0208338_1000142); c00183_3300027.. (original name was: 3300027514.a:Ga0208338_1000145); c00184_3300027.. (original name was: 3300027514.a:Ga0208338_1000157); c00185_3300027.. (original name was: 3300027514.a:Ga0208338_1000163); c00187_3300027.. (original name was: 3300027514.a:Ga0208338_1000165); c00188_3300027.. (original name was: 3300027514.a:Ga0208338_1000139)

Compact view

c00003_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 4,759 nt. (total: 4,759 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00014_3300027.. - Region 1 - NRPS-like

Download region GenBank file

Location: 13,987 - 47,966 nt. (total: 33,980 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 13986 - 47966:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_29

Search NORINE for peptide: strict or relaxed

AMP-binding (35..439): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

c00032_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 3,468 nt. (total: 3,468 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 3468:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg32_1

Search NORINE for peptide: strict or relaxed

AMP-binding (5..268): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00034_3300027.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1,468 - 71,146 nt. (total: 69,679 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 1467 - 71146:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (gly) + (ala-b) + (val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 33749 - 71146:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (gly) + (ala-b) + (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg34_21

PKS_AT (616..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Propionyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.3
Methoxymalonyl-CoA: 59.3
Methylmalonyl-CoA: 50.0
inactive: 39.7
Propionyl-CoA: 24.2
CHC-CoA: 19.0
fatty_acid: 16.8
Benzoyl-CoA: 13.9
Isobutyryl-CoA: 13.5
Ethylmalonyl-CoA: 13.5
trans-1,2-CPDA: 12.1
2-Methylbutyryl-CoA: 11.6
Acetyl-CoA: 9.4
3-Methylbutyryl-CoA: 0.0

ctg34_41

Search NORINE for peptide: strict or relaxed

AMP-binding (451..850): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

ctg34_42

Search NORINE for peptide: strict or relaxed

AMP-binding (497..900): ala-b

NRPSPredictor2: ala-b

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: aDWVvSLADK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 80% (moderate)

ctg34_43

Search NORINE for peptide: strict or relaxed

AMP-binding (475..866): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGMIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

ctg34_44

Search NORINE for peptide: strict or relaxed

AMP-binding (478..887): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

c00035_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,531 nt. (total: 13,531 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13531:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg35_3

Search NORINE for peptide: strict or relaxed

AMP-binding (18..406): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: stGtrSSmiK
Nearest Stachelhaus code:: dab
Stachelhaus code match:: 40% (weak)

c00038_3300027.. - Region 1 - lassopeptide

Download region GenBank file

Location: 77,792 - 100,549 nt. (total: 22,758 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptides - No core peptides found.

Lasso peptides

Core peptide predictions

No core peptides found.

c00040_3300027.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 28,126 - 66,976 nt. (total: 38,851 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 28125 - 66976:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg40_45

PKS_AT (528..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.1
inactive: 107.6
Methoxymalonyl-CoA: 86.3
Methylmalonyl-CoA: 70.0
Ethylmalonyl-CoA: 53.7
Propionyl-CoA: 51.8
2-Methylbutyryl-CoA: 36.6
CHC-CoA: 33.1
Isobutyryl-CoA: 32.1
Benzoyl-CoA: 24.1
Acetyl-CoA: 18.2
fatty_acid: 17.9
trans-1,2-CPDA: 17.6
3-Methylbutyryl-CoA: 10.7

ctg40_49

Search NORINE for peptide: strict or relaxed

AMP-binding (250..645): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00072_3300027.. - Region 1 - lassopeptide

Download region GenBank file

Location: 13,151 - 26,507 nt. (total: 13,357 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lasso peptides

Lasso peptide predictions

Lassopeptide(s) for ctg72_36 - Putative Class II

ctg72_36 leader / core peptide / cleaved tail: MNTCKKGGKQMQNNYEAPELTLIGEANEVVM - GSAIGGDDFPKQFGLDFEFEQD

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

ctg72_36 - Class II: Cleavage pHMM score: -9.50; RODEO score: 16; Monoisotopic mass: 2400.0 Da; Molecular weight: 2401.5 Da; Number of bridges: 0

c00081_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 13,498 nt. (total: 13,498 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 13498:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg81_2

Search NORINE for peptide: strict or relaxed

AMP-binding (456..857): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLaiVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

ctg81_5

Search NORINE for peptide: strict or relaxed

AMP-binding (719..1119): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00082_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 38,358 nt. (total: 38,358 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala) + (X - X) + (X) + (D-X) + (X - leu) + (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg82_1

Search NORINE for peptide: strict or relaxed

AMP-binding (580..970): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg82_2

Search NORINE for peptide: strict or relaxed

AMP-binding (467..871): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPRHfGfqaK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

AMP-binding (1527..1929): X

NRPSPredictor2: hydrophobic-aromatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeItAdDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 60% (weak)

ctg82_3

Search NORINE for peptide: strict or relaxed

A-OX (515..1281): X

ctg82_4

Search NORINE for peptide: strict or relaxed

AMP-binding (438..841): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKLGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg82_8

Search NORINE for peptide: strict or relaxed

AMP-binding (508..905): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLaiVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (1564..1960): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg82_9

Search NORINE for peptide: strict or relaxed

AMP-binding (508..911): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1578..1917): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00085_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 5,416 nt. (total: 5,416 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 5416:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg85_2

Search NORINE for peptide: strict or relaxed

AMP-binding (473..870): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAfWLGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00086_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 8,006 nt. (total: 8,006 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 8006:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg86_4

Search NORINE for peptide: strict or relaxed

CAL_domain (35..447): pk

minowa: NH2

Prediction, score:

NH2: 244.8
Acetyl-CoA: 66.8
fatty_acid: 35.1
shikimic_acid: 7.9
AHBA: -2.1

AMP-binding (1103..1480): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

c00095_3300027.. - Region 1 - microviridin

Download region GenBank file

Location: 86,353 - 103,680 nt. (total: 17,328 nt) Show pHMM detection rules used

Region on contig edge.

microviridin: (mvd or mvnA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00103_3300027.. - Region 1 - arylpolyene

Download region GenBank file

Location: 1 - 22,603 nt. (total: 22,603 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00104_3300027.. - Region 1 - NRPS,T1PKS,bacteriocin

Download region GenBank file

Location: 1 - 115,218 nt. (total: 115,218 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 115218:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr) + (gly) + (ohmal) + (X - pro - cys) + (D-orn - ala) + (leu - X) + (X - tyr - asn - thr - X) + (leu - val - X - thr - leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg104_1

Search NORINE for peptide: strict or relaxed

AMP-binding (6..268): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DpwyIGSIaK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (926..1327): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DALWvGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

AMP-binding (1992..2396): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMEqaGtItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

AMP-binding (3051..3462): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (4115..4567): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DpwyIGSIaK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 60% (weak)

ctg104_13

Search NORINE for peptide: strict or relaxed

AMP-binding (489..887): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DifQFGLIiK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 70% (weak)

AMP-binding (1547..1962): tyr

NRPSPredictor2: tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: tyr

Stachelhaus prediction details:

Stachelhaus sequence:: DArsLsqMsK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

AMP-binding (2625..3016): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

AMP-binding (3660..4048): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (5038..5427): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DplHmGnIiK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 50% (weak)

ctg104_14

Search NORINE for peptide: strict or relaxed

AMP-binding (500..871): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (1904..2288): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAItK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

ctg104_16

Search NORINE for peptide: strict or relaxed

CAL_domain (44..474): pk

minowa: NH2

Prediction, score:

NH2: 32.1
AHBA: 30.0
shikimic_acid: 17.9
Acetyl-CoA: -3.0
fatty_acid: -3.4

AMP-binding (1201..1607): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEIGSVDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (2711..3101): ala

NRPSPredictor2: ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: ala

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNNALTYK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 100% (strong)

ctg104_18

Search NORINE for peptide: strict or relaxed

AMP-binding (502..901): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DILhLGLIiK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

AMP-binding (1556..1939): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAHlVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

AMP-binding (3003..3283): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DlydfAmVYK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 50% (weak)

ctg104_20

PKS_AT (529..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.0
inactive: 110.1
Methoxymalonyl-CoA: 79.0
Methylmalonyl-CoA: 73.4
Isobutyryl-CoA: 56.2
Propionyl-CoA: 49.6
Ethylmalonyl-CoA: 34.1
Benzoyl-CoA: 33.3
2-Methylbutyryl-CoA: 23.0
Acetyl-CoA: 20.5
CHC-CoA: 20.1
fatty_acid: 17.9
trans-1,2-CPDA: 15.0
3-Methylbutyryl-CoA: 8.4

ctg104_22

Search NORINE for peptide: strict or relaxed

AMP-binding (512..890): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DILhLGLIiK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 80% (moderate)

ctg104_26

Search NORINE for peptide: strict or relaxed

AMP-binding (486..874): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00109_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 7,480 - 55,539 nt. (total: 48,060 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 7479 - 55539:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg109_27

Search NORINE for peptide: strict or relaxed

AMP-binding (482..889): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFIAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 90% (moderate)

ctg109_28

Search NORINE for peptide: strict or relaxed

AMP-binding (257..629): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: seYdfSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 60% (weak)

ctg109_36

Search NORINE for peptide: strict or relaxed

AMP-binding (0..329): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVmTmGGViK
Nearest Stachelhaus code:: N-(1,1-dimethyl-1-allyl)Trp
Stachelhaus code match:: 70% (weak)

ctg109_38

Search NORINE for peptide: strict or relaxed

AMP-binding (532..931): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

c00126_3300027.. - Region 1 - bacteriocin

Download region GenBank file

Location: 436 - 12,274 nt. (total: 11,839 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00129_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 24,750 nt. (total: 24,750 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00136_3300027.. - Region 1 - NRPS-like

Download region GenBank file

Location: 9,427 - 53,821 nt. (total: 44,395 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 9426 - 53821:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg136_24

Search NORINE for peptide: strict or relaxed

AMP-binding (567..999): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: eFtviGGpVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 50% (weak)

c00146_3300027.. - Region 1 - T3PKS

Download region GenBank file

Location: 1 - 32,703 nt. (total: 32,703 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00152_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 52,517 nt. (total: 52,517 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 52517:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (thr - asn) + (X) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg152_1

Search NORINE for peptide: strict or relaxed

AMP-binding (222..623): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DAFFLGVTyK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 90% (moderate)

ctg152_6

Search NORINE for peptide: strict or relaxed

AMP-binding (9..419): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DgrhLAlmAK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 50% (weak)

AMP-binding (1072..1472): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVeEIGvItK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 70% (weak)

ctg152_11

Search NORINE for peptide: strict or relaxed

AMP-binding (509..913): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (1869..2262): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)

ctg152_12

Search NORINE for peptide: strict or relaxed

CAL_domain (132..439): pk

minowa: NH2

Prediction, score:

NH2: 176.8
Acetyl-CoA: 36.8
fatty_acid: 12.6
shikimic_acid: 0.0
AHBA: 0.0

A-OX (1141..1902): X

c00161_3300027.. - Region 1 - NRPS-like

Download region GenBank file

Location: 1 - 26,767 nt. (total: 26,767 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26767:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg161_16

Search NORINE for peptide: strict or relaxed

AMP-binding (4..223): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: --W-IgGslK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

c00186_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 19,202 nt. (total: 19,202 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 19202:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (asn) + (X) + (ala-b) + (D-asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg186_1

Search NORINE for peptide: strict or relaxed

AMP-binding (419..817): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHVGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

ctg186_3

Search NORINE for peptide: strict or relaxed

AMP-binding (503..903): ala-b

NRPSPredictor2: ala-b

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: phe

Stachelhaus prediction details:

Stachelhaus sequence:: VDWVvSLADK
Nearest Stachelhaus code:: ala-b
Stachelhaus code match:: 90% (moderate)

ctg186_5

Search NORINE for peptide: strict or relaxed

AMP-binding (432..831): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGhVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 90% (moderate)

ctg186_7

Search NORINE for peptide: strict or relaxed

AMP-binding (0..266): asn

NRPSPredictor2: asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asn

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKIGEVGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 100% (strong)