3300027800_14 - 17 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00001_3300027.. (original name was: 3300027800.a:Ga0209800_10008374)

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	NRPS	1	6,421

c00002_3300027.. (original name was: 3300027800.a:Ga0209800_10004896)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	NRPS	1	9,629

c00004_3300027.. (original name was: 3300027800.a:Ga0209800_10000045)

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	NRPS,T1PKS	1	87,620

c00005_3300027.. (original name was: 3300027800.a:Ga0209800_10000016)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	270,857	322,019

c00010_3300027.. (original name was: 3300027800.a:Ga0209800_10000095)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS	1	32,832

c00013_3300027.. (original name was: 3300027800.a:Ga0209800_10000053)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	NRPS-like	145,630	189,427

c00014_3300027.. (original name was: 3300027800.a:Ga0209800_10000120)

Region	Type	From	To	Most similar known cluster		Similarity
Region 14.1	T1PKS,bacteriocin	1	25,062
Region 14.2	NRPS,transAT-PKS	94,597	169,634

c00015_3300027.. (original name was: 3300027800.a:Ga0209800_10000784)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS	4,262	41,044

c00016_3300027.. (original name was: 3300027800.a:Ga0209800_10000019)

Region	Type	From	To	Most similar known cluster		Similarity
Region 16.1	bacteriocin	89,824	100,681

c00018_3300027.. (original name was: 3300027800.a:Ga0209800_10000318)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	hserlactone	42,153	62,758

c00020_3300027.. (original name was: 3300027800.a:Ga0209800_10000056)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	NRPS	49,352	97,093
Region 20.2	lanthipeptide	143,554	166,256

c00021_3300027.. (original name was: 3300027800.a:Ga0209800_10000009)

Region	Type	From	To
Region 21.1	lanthipeptide	105,438	128,287
Region 21.2	transAT-PKS,PKS-like	444,790	570,588
Region 21.3	bacteriocin	616,282	627,136

c00022_3300027.. (original name was: 3300027800.a:Ga0209800_10000195)

Region	Type	From	To	Most similar known cluster		Similarity
Region 22.1	arylpolyene	5,420	46,751

Region	Type	From	To	Similarity
Region 1.1	NRPS	1	6,421
Region 2.1	NRPS	1	9,629
Region 4.1	NRPS,T1PKS	1	87,620
Region 5.1	NRPS	270,857	322,019
Region 10.1	NRPS	1	32,832
Region 13.1	NRPS-like	145,630	189,427
Region 14.1	T1PKS,bacteriocin	1	25,062
Region 14.2	NRPS,transAT-PKS	94,597	169,634
Region 15.1	NRPS	4,262	41,044
Region 16.1	bacteriocin	89,824	100,681
Region 18.1	hserlactone	42,153	62,758
Region 20.1	NRPS	49,352	97,093
Region 20.2	lanthipeptide	143,554	166,256
Region 21.1	lanthipeptide	105,438	128,287
Region 21.2	transAT-PKS,PKS-like	444,790	570,588
Region 21.3	bacteriocin	616,282	627,136
Region 22.1	arylpolyene	5,420	46,751

No secondary metabolite regions were found in these records:: c00003_3300027.. (original name was: 3300027800.a:Ga0209800_10000206); c00006_3300027.. (original name was: 3300027800.a:Ga0209800_10002035); c00007_3300027.. (original name was: 3300027800.a:Ga0209800_10001189); c00008_3300027.. (original name was: 3300027800.a:Ga0209800_10000131); c00009_3300027.. (original name was: 3300027800.a:Ga0209800_10001204); c00011_3300027.. (original name was: 3300027800.a:Ga0209800_10000133); c00012_3300027.. (original name was: 3300027800.a:Ga0209800_10003411); c00017_3300027.. (original name was: 3300027800.a:Ga0209800_10001822); c00019_3300027.. (original name was: 3300027800.a:Ga0209800_10000332); c00023_3300027.. (original name was: 3300027800.a:Ga0209800_10000101); c00024_3300027.. (original name was: 3300027800.a:Ga0209800_10000336)

Compact view

c00001_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 6,421 nt. (total: 6,421 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 6421:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1

Search NORINE for peptide: strict or relaxed

AMP-binding (778..1180): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1871..2139): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQF-----K
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 50% (weak)

c00002_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 9,629 nt. (total: 9,629 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 9629:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg2_1

Search NORINE for peptide: strict or relaxed

AMP-binding (771..1176): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVenVGAInK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 70% (weak)

AMP-binding (1833..2237): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMveLGMVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

ctg2_2

Search NORINE for peptide: strict or relaxed

AMP-binding (560..785): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVW------K
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 40% (weak)

c00004_3300027.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Location: 1 - 87,620 nt. (total: 87,620 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 87620:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - asp) + (ser) + (leu) + (ser - thr - X) + (X) + (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg4_18

Search NORINE for peptide: strict or relaxed

CAL_domain (43..503): pk

minowa: AHBA

Prediction, score:

AHBA: 21.4
NH2: 16.8
fatty_acid: 16.4
shikimic_acid: 0.0
Acetyl-CoA: -3.1

AMP-binding (1176..1575): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vrraFGfsDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 40% (weak)

ctg4_25

PKS_AT (538..821): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 151.0
inactive: 92.4
Methoxymalonyl-CoA: 55.9
Methylmalonyl-CoA: 49.3
Propionyl-CoA: 26.3
Ethylmalonyl-CoA: 21.9
2-Methylbutyryl-CoA: 21.4
CHC-CoA: 20.3
Benzoyl-CoA: 17.5
Isobutyryl-CoA: 13.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

ctg4_26

Search NORINE for peptide: strict or relaxed

AMP-binding (541..933): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DswdIGfiGK
Nearest Stachelhaus code:: asn
Stachelhaus code match:: 50% (weak)

ctg4_27

Search NORINE for peptide: strict or relaxed

AMP-binding (549..955): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISqIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (1615..2019): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (2686..3084): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAlDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 90% (moderate)

ctg4_28

Search NORINE for peptide: strict or relaxed

AMP-binding (521..919): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAFdLGCVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

ctg4_29

Search NORINE for peptide: strict or relaxed

AMP-binding (551..956): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHMShIeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 80% (moderate)

ctg4_30

Search NORINE for peptide: strict or relaxed

PKS_AT (532..815): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 168.1
inactive: 91.8
Methoxymalonyl-CoA: 74.0
Methylmalonyl-CoA: 62.5
Isobutyryl-CoA: 46.9
Propionyl-CoA: 42.9
Benzoyl-CoA: 31.9
Ethylmalonyl-CoA: 27.7
Acetyl-CoA: 22.6
fatty_acid: 20.5
trans-1,2-CPDA: 17.7
3-Methylbutyryl-CoA: 16.2
2-Methylbutyryl-CoA: 16.0
CHC-CoA: 15.3

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

AMP-binding (1866..2266): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMeDLGMVsK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

c00005_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 270,857 - 322,019 nt. (total: 51,163 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 270856 - 322019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (gly) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_262

Search NORINE for peptide: strict or relaxed

AMP-binding (446..840): X

NRPSPredictor2: gly, ala, val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DItQitLVyK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 60% (weak)

ctg5_263

Search NORINE for peptide: strict or relaxed

AMP-binding (517..910): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGVvWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 90% (moderate)

ctg5_264

Search NORINE for peptide: strict or relaxed

AMP-binding (524..928): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAgDmGhVcK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00010_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 32,832 nt. (total: 32,832 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00013_3300027.. - Region 1 - NRPS-like

Download region GenBank file

Location: 145,630 - 189,427 nt. (total: 43,798 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 145629 - 189427:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg13_142

Search NORINE for peptide: strict or relaxed

AMP-binding (55..450): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPmivGVVyK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 60% (weak)

c00014_3300027.. - Region 1 - T1PKS,bacteriocin

Download region GenBank file

Location: 1 - 25,062 nt. (total: 25,062 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 25062:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_2

PKS_AT (547..836): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 34.7
inactive: 34.6
Methoxymalonyl-CoA: 22.3
Methylmalonyl-CoA: 21.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

c00014_3300027.. - Region 2 - NRPS,transAT-PKS

Download region GenBank file

Location: 94,597 - 169,634 nt. (total: 75,038 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
transAT-PKS: (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 94596 - 169634:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-ser - X - X) + (ccmal - mal - ccmal) + (asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 94596 - 136548:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-ser - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 111984 - 169634:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-ser - X - X) + (ccmal - mal - ccmal) + (asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 144176 - 169634:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal) + (asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg14_87

Search NORINE for peptide: strict or relaxed

AMP-binding (225..631): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAaamAAIlK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 60% (weak)

AMP-binding (1761..2159): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (3287..3682): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DaGamAGiLK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 60% (weak)

AMP-binding (4350..4753): X

NRPSPredictor2: hydrophilic

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DiWeMtadDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

ctg14_88

PKS_AT (6..280): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 124.8
Methoxymalonyl-CoA: 47.2
inactive: 41.9
Methylmalonyl-CoA: 37.0
Propionyl-CoA: 31.2
fatty_acid: 10.9
Isobutyryl-CoA: 10.5
2-Methylbutyryl-CoA: 10.4
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

PKS_AT (311..587): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 48.6
inactive: 38.7
Methoxymalonyl-CoA: 22.5
Methylmalonyl-CoA: 19.9
Isobutyryl-CoA: 12.9
Propionyl-CoA: 11.3
Benzoyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

ctg14_100

Search NORINE for peptide: strict or relaxed

AMP-binding (681..1086): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMveLGMVDK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 80% (moderate)

c00015_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 4,262 - 41,044 nt. (total: 36,783 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 4261 - 41044:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - val - X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_29

Search NORINE for peptide: strict or relaxed

AMP-binding (504..906): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DALfVGgVVK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 80% (moderate)

ctg15_30

Search NORINE for peptide: strict or relaxed

AMP-binding (11..418): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAfTIAAIwK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 80% (moderate)

AMP-binding (1118..1541): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAfLIGAVvK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (2208..2611): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAvDLGaVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

c00016_3300027.. - Region 1 - bacteriocin

Download region GenBank file

Location: 89,824 - 100,681 nt. (total: 10,858 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00018_3300027.. - Region 1 - hserlactone

Download region GenBank file

Location: 42,153 - 62,758 nt. (total: 20,606 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00020_3300027.. - Region 1 - NRPS

Download region GenBank file

Location: 49,352 - 97,093 nt. (total: 47,742 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 49351 - 97093:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg20_59

CAL_domain (101..423): pk

minowa: NH2

Prediction, score:

NH2: 35.5
fatty_acid: 26.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

ctg20_62

Search NORINE for peptide: strict or relaxed

AMP-binding (486..871): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNMSlIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

c00020_3300027.. - Region 2 - lanthipeptide

Download region GenBank file

Location: 143,554 - 166,256 nt. (total: 22,703 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg20_134 - Putative Class III

ctg20_133 leader / core peptide: MERILDLQKLNDALDSDAEAVAR - DhaDhbQDhaDDhaACDhaDhbLDhaLDhaDhaCDhaIDhaDhbEFVAI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg20_133 - Class III

Cleavage pHMM score: 2.80

RODEO score: 0

Monoisotopic mass: 2307.1 Da

Molecular weight: 2308.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2326.5 Da N = 1; 2344.5 Da N = 2; 2362.6 Da N = 3; 2380.6 Da N = 4; 2398.6 Da N = 5; 2416.6 Da N = 6; 2434.6 Da N = 7; 2452.7 Da N = 8; 2470.7 Da N = 9; 2488.7 Da N = 10

c00021_3300027.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 105,438 - 128,287 nt. (total: 22,850 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg21_93 - Putative Class II

ctg21_91 leader / core peptide: MNSSTILKAWKQSEGKASIEQVAGM - PVVDENLLRQIGGGQQQQNREFDhaDhaGFFCDhaVDhaGECNGGDhbDhaCWPF
ctg21_92 leader / core peptide: MNTSTILKAWKQSEGKAAIEHVAGMPVVDENLLRQIAGG - LQQHPEFDhaDhaGYFCDhbVDhaGECNGGDhbDhaCWPF

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg21_91 - Class II

Cleavage pHMM score: -2.70

RODEO score: 0

Monoisotopic mass: 4556.1 Da

Molecular weight: 4558.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4576.9 Da N = 1; 4595.0 Da N = 2; 4613.0 Da N = 3

ctg21_92 - Class II

Cleavage pHMM score: -0.70

RODEO score: 0

Monoisotopic mass: 2959.3 Da

Molecular weight: 2961.2 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2979.2 Da N = 1; 2997.2 Da N = 2; 3015.3 Da N = 3

c00021_3300027.. - Region 2 - PKS-like,transAT-PKS

Download region GenBank file

Location: 444,790 - 570,588 nt. (total: 125,799 nt) Show pHMM detection rules used

transAT-PKS: (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 444789 - 570588:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal) + (mal - ohmal) + (ccmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_394

PKS_AT (8..298): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 24.0
inactive: 18.7
Methoxymalonyl-CoA: 12.4
Isobutyryl-CoA: 8.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; inactive: 54.2%

ctg21_409

Search NORINE for peptide: strict or relaxed

AMP-binding (12..359): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: iGnpTGtilK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 40% (weak)

ctg21_413

PKS_AT (7..297): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 39.1
Methoxymalonyl-CoA: 25.4
Methylmalonyl-CoA: 16.4
inactive: 13.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: (unknown)

No matches above 50%

ctg21_414

PKS_AT (4..284): mal

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 82.8
inactive: 25.3
Methoxymalonyl-CoA: 23.4
Methylmalonyl-CoA: 17.9
fatty_acid: 11.3
Propionyl-CoA: 9.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

c00021_3300027.. - Region 3 - bacteriocin

Download region GenBank file

Location: 616,282 - 627,136 nt. (total: 10,855 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

c00022_3300027.. - Region 1 - arylpolyene

Download region GenBank file

Location: 5,420 - 46,751 nt. (total: 41,332 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it