3300028992_5 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00032_3300028.. (original name was: 3300028992.a:Ga0169609_100239)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	sactipeptide	30,186	50,081

c00035_3300028.. (original name was: 3300028992.a:Ga0169609_100145)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	NRPS	1	27,980

c00055_3300028.. (original name was: 3300028992.a:Ga0169609_100161)

Region	Type	From	To	Most similar known cluster		Similarity
Region 55.1	lanthipeptide	51,604	67,721

c00058_3300028.. (original name was: 3300028992.a:Ga0169609_100144)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	NRPS	2,593	51,577

Region	Type	From	To	Similarity
Region 32.1	sactipeptide	30,186	50,081
Region 35.1	NRPS	1	27,980
Region 55.1	lanthipeptide	51,604	67,721
Region 58.1	NRPS	2,593	51,577

No secondary metabolite regions were found in these records:: c00001_3300028.. (original name was: 3300028992.a:Ga0169609_102153); c00002_3300028.. (original name was: 3300028992.a:Ga0169609_101432); c00003_3300028.. (original name was: 3300028992.a:Ga0169609_101277); c00004_3300028.. (original name was: 3300028992.a:Ga0169609_101251); c00005_3300028.. (original name was: 3300028992.a:Ga0169609_101208); c00006_3300028.. (original name was: 3300028992.a:Ga0169609_101197); c00007_3300028.. (original name was: 3300028992.a:Ga0169609_101104); c00008_3300028.. (original name was: 3300028992.a:Ga0169609_101071); c00009_3300028.. (original name was: 3300028992.a:Ga0169609_102357); c00010_3300028.. (original name was: 3300028992.a:Ga0169609_100999); c00011_3300028.. (original name was: 3300028992.a:Ga0169609_100998); c00012_3300028.. (original name was: 3300028992.a:Ga0169609_100915); c00013_3300028.. (original name was: 3300028992.a:Ga0169609_100895); c00014_3300028.. (original name was: 3300028992.a:Ga0169609_100876); c00015_3300028.. (original name was: 3300028992.a:Ga0169609_101648); c00016_3300028.. (original name was: 3300028992.a:Ga0169609_100872); c00017_3300028.. (original name was: 3300028992.a:Ga0169609_101120); c00018_3300028.. (original name was: 3300028992.a:Ga0169609_100829); c00019_3300028.. (original name was: 3300028992.a:Ga0169609_100806); c00020_3300028.. (original name was: 3300028992.a:Ga0169609_100677); c00021_3300028.. (original name was: 3300028992.a:Ga0169609_100664); c00022_3300028.. (original name was: 3300028992.a:Ga0169609_100946); c00023_3300028.. (original name was: 3300028992.a:Ga0169609_100655); c00024_3300028.. (original name was: 3300028992.a:Ga0169609_100625); c00025_3300028.. (original name was: 3300028992.a:Ga0169609_101661); c00026_3300028.. (original name was: 3300028992.a:Ga0169609_100594); c00027_3300028.. (original name was: 3300028992.a:Ga0169609_100456); c00028_3300028.. (original name was: 3300028992.a:Ga0169609_100133); c00029_3300028.. (original name was: 3300028992.a:Ga0169609_100131); c00030_3300028.. (original name was: 3300028992.a:Ga0169609_100460); c00031_3300028.. (original name was: 3300028992.a:Ga0169609_101015); c00033_3300028.. (original name was: 3300028992.a:Ga0169609_101115); c00034_3300028.. (original name was: 3300028992.a:Ga0169609_100727); c00036_3300028.. (original name was: 3300028992.a:Ga0169609_100221); c00037_3300028.. (original name was: 3300028992.a:Ga0169609_100124); c00038_3300028.. (original name was: 3300028992.a:Ga0169609_100265); c00039_3300028.. (original name was: 3300028992.a:Ga0169609_101562); c00040_3300028.. (original name was: 3300028992.a:Ga0169609_101368); c00041_3300028.. (original name was: 3300028992.a:Ga0169609_100107); c00042_3300028.. (original name was: 3300028992.a:Ga0169609_100342); c00043_3300028.. (original name was: 3300028992.a:Ga0169609_100008); c00044_3300028.. (original name was: 3300028992.a:Ga0169609_102068); c00045_3300028.. (original name was: 3300028992.a:Ga0169609_100128); c00046_3300028.. (original name was: 3300028992.a:Ga0169609_100031); c00047_3300028.. (original name was: 3300028992.a:Ga0169609_100554); c00048_3300028.. (original name was: 3300028992.a:Ga0169609_100166); c00049_3300028.. (original name was: 3300028992.a:Ga0169609_100360); c00050_3300028.. (original name was: 3300028992.a:Ga0169609_100657); c00051_3300028.. (original name was: 3300028992.a:Ga0169609_100075); c00052_3300028.. (original name was: 3300028992.a:Ga0169609_100207); c00053_3300028.. (original name was: 3300028992.a:Ga0169609_100066); c00054_3300028.. (original name was: 3300028992.a:Ga0169609_100646); c00056_3300028.. (original name was: 3300028992.a:Ga0169609_101466); c00057_3300028.. (original name was: 3300028992.a:Ga0169609_100302); c00059_3300028.. (original name was: 3300028992.a:Ga0169609_100047); c00060_3300028.. (original name was: 3300028992.a:Ga0169609_100961); c00061_3300028.. (original name was: 3300028992.a:Ga0169609_100282); c00062_3300028.. (original name was: 3300028992.a:Ga0169609_101199); c00063_3300028.. (original name was: 3300028992.a:Ga0169609_100423); c00064_3300028.. (original name was: 3300028992.a:Ga0169609_100058); c00065_3300028.. (original name was: 3300028992.a:Ga0169609_100481); c00066_3300028.. (original name was: 3300028992.a:Ga0169609_100158); c00067_3300028.. (original name was: 3300028992.a:Ga0169609_100046); c00068_3300028.. (original name was: 3300028992.a:Ga0169609_100240); c00069_3300028.. (original name was: 3300028992.a:Ga0169609_100381); c00070_3300028.. (original name was: 3300028992.a:Ga0169609_101342); c00071_3300028.. (original name was: 3300028992.a:Ga0169609_100275); c00072_3300028.. (original name was: 3300028992.a:Ga0169609_101540); c00073_3300028.. (original name was: 3300028992.a:Ga0169609_100279); c00074_3300028.. (original name was: 3300028992.a:Ga0169609_100086); c00075_3300028.. (original name was: 3300028992.a:Ga0169609_100474); c00076_3300028.. (original name was: 3300028992.a:Ga0169609_100280); c00077_3300028.. (original name was: 3300028992.a:Ga0169609_100331); c00078_3300028.. (original name was: 3300028992.a:Ga0169609_100350); c00079_3300028.. (original name was: 3300028992.a:Ga0169609_100351); c00080_3300028.. (original name was: 3300028992.a:Ga0169609_100007); c00081_3300028.. (original name was: 3300028992.a:Ga0169609_100492); c00082_3300028.. (original name was: 3300028992.a:Ga0169609_100565); c00083_3300028.. (original name was: 3300028992.a:Ga0169609_100371); c00084_3300028.. (original name was: 3300028992.a:Ga0169609_100632); c00085_3300028.. (original name was: 3300028992.a:Ga0169609_100438); c00086_3300028.. (original name was: 3300028992.a:Ga0169609_100494); c00087_3300028.. (original name was: 3300028992.a:Ga0169609_100502); c00088_3300028.. (original name was: 3300028992.a:Ga0169609_100511)

Compact view

c00032_3300028.. - Region 1 - sactipeptide

Download region GenBank file

Location: 30,186 - 50,081 nt. (total: 19,896 nt) Show pHMM detection rules used

Region on contig edge.

sactipeptide: (subtilosin or thuricin or TIGR04404 or TIGR03973)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Sactipeptides

Sactipeptide predictions

Sactipeptides - No core peptides found.

Sactipeptides

Core peptide predictions

No core peptides found.

c00035_3300028.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 27,980 nt. (total: 27,980 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00055_3300028.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 51,604 - 67,721 nt. (total: 16,118 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg55_69 - Putative Class II

ctg55_70 leader / core peptide: MTEEFIGCIEEELKEIELFYEENGVEVEAYTLHNG - DhaFFDhaICC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg55_70 - Class II: Cleavage pHMM score: -6.60; RODEO score: 0; Monoisotopic mass: 769.3 Da; Molecular weight: 769.9 Da; Number of bridges: 2

c00058_3300028.. - Region 1 - NRPS

Download region GenBank file

Location: 2,593 - 51,577 nt. (total: 48,985 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 2592 - 51577:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_20

Search NORINE for peptide: strict or relaxed

AMP-binding (20..419): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLtdgGIsK
Nearest Stachelhaus code:: aeo
Stachelhaus code match:: 60% (weak)

AMP-binding (1033..1421): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmfsGAIfK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 60% (weak)

AMP-binding (2027..2418): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAiTTGgVsK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)