3300029012_5 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00041_3300029.. (original name was: 3300029012.a:Ga0169674_100124)

Region	Type	From	To	Most similar known cluster		Similarity
Region 41.1	lanthipeptide	1	21,002

c00054_3300029.. (original name was: 3300029012.a:Ga0169674_100079)

Region	Type	From	To	Most similar known cluster		Similarity
Region 54.1	NRPS	1	26,540

c00058_3300029.. (original name was: 3300029012.a:Ga0169674_100465)

Region	Type	From	To	Most similar known cluster		Similarity
Region 58.1	NRPS	1	22,187

c00061_3300029.. (original name was: 3300029012.a:Ga0169674_100615)

Region	Type	From	To	Most similar known cluster		Similarity
Region 61.1	sactipeptide	1	14,031

Region	Type	From	To	Similarity
Region 41.1	lanthipeptide	1	21,002
Region 54.1	NRPS	1	26,540
Region 58.1	NRPS	1	22,187
Region 61.1	sactipeptide	1	14,031

No secondary metabolite regions were found in these records:: c00001_3300029.. (original name was: 3300029012.a:Ga0169674_102294); c00002_3300029.. (original name was: 3300029012.a:Ga0169674_102255); c00003_3300029.. (original name was: 3300029012.a:Ga0169674_102115); c00004_3300029.. (original name was: 3300029012.a:Ga0169674_102024); c00005_3300029.. (original name was: 3300029012.a:Ga0169674_101830); c00006_3300029.. (original name was: 3300029012.a:Ga0169674_101803); c00007_3300029.. (original name was: 3300029012.a:Ga0169674_101678); c00008_3300029.. (original name was: 3300029012.a:Ga0169674_101398); c00009_3300029.. (original name was: 3300029012.a:Ga0169674_102400); c00010_3300029.. (original name was: 3300029012.a:Ga0169674_101527); c00011_3300029.. (original name was: 3300029012.a:Ga0169674_101236); c00012_3300029.. (original name was: 3300029012.a:Ga0169674_101199); c00013_3300029.. (original name was: 3300029012.a:Ga0169674_101155); c00014_3300029.. (original name was: 3300029012.a:Ga0169674_101590); c00015_3300029.. (original name was: 3300029012.a:Ga0169674_101105); c00016_3300029.. (original name was: 3300029012.a:Ga0169674_101065); c00017_3300029.. (original name was: 3300029012.a:Ga0169674_100969); c00018_3300029.. (original name was: 3300029012.a:Ga0169674_100941); c00019_3300029.. (original name was: 3300029012.a:Ga0169674_100880); c00020_3300029.. (original name was: 3300029012.a:Ga0169674_101653); c00021_3300029.. (original name was: 3300029012.a:Ga0169674_101168); c00022_3300029.. (original name was: 3300029012.a:Ga0169674_100780); c00023_3300029.. (original name was: 3300029012.a:Ga0169674_100762); c00024_3300029.. (original name was: 3300029012.a:Ga0169674_100730); c00025_3300029.. (original name was: 3300029012.a:Ga0169674_100701); c00026_3300029.. (original name was: 3300029012.a:Ga0169674_102237); c00027_3300029.. (original name was: 3300029012.a:Ga0169674_100685); c00028_3300029.. (original name was: 3300029012.a:Ga0169674_100651); c00029_3300029.. (original name was: 3300029012.a:Ga0169674_100593); c00030_3300029.. (original name was: 3300029012.a:Ga0169674_100591); c00031_3300029.. (original name was: 3300029012.a:Ga0169674_100572); c00032_3300029.. (original name was: 3300029012.a:Ga0169674_100547); c00033_3300029.. (original name was: 3300029012.a:Ga0169674_100222); c00034_3300029.. (original name was: 3300029012.a:Ga0169674_100207); c00035_3300029.. (original name was: 3300029012.a:Ga0169674_100094); c00036_3300029.. (original name was: 3300029012.a:Ga0169674_101132); c00037_3300029.. (original name was: 3300029012.a:Ga0169674_100162); c00038_3300029.. (original name was: 3300029012.a:Ga0169674_100144); c00039_3300029.. (original name was: 3300029012.a:Ga0169674_101205); c00040_3300029.. (original name was: 3300029012.a:Ga0169674_100332); c00042_3300029.. (original name was: 3300029012.a:Ga0169674_100143); c00043_3300029.. (original name was: 3300029012.a:Ga0169674_100120); c00044_3300029.. (original name was: 3300029012.a:Ga0169674_101713); c00045_3300029.. (original name was: 3300029012.a:Ga0169674_100064); c00046_3300029.. (original name was: 3300029012.a:Ga0169674_100111); c00047_3300029.. (original name was: 3300029012.a:Ga0169674_100477); c00048_3300029.. (original name was: 3300029012.a:Ga0169674_100754); c00049_3300029.. (original name was: 3300029012.a:Ga0169674_100172); c00050_3300029.. (original name was: 3300029012.a:Ga0169674_100759); c00051_3300029.. (original name was: 3300029012.a:Ga0169674_100080); c00052_3300029.. (original name was: 3300029012.a:Ga0169674_100188); c00053_3300029.. (original name was: 3300029012.a:Ga0169674_100091); c00055_3300029.. (original name was: 3300029012.a:Ga0169674_100102); c00056_3300029.. (original name was: 3300029012.a:Ga0169674_100230); c00057_3300029.. (original name was: 3300029012.a:Ga0169674_101823); c00059_3300029.. (original name was: 3300029012.a:Ga0169674_100118); c00060_3300029.. (original name was: 3300029012.a:Ga0169674_100306); c00062_3300029.. (original name was: 3300029012.a:Ga0169674_100227); c00063_3300029.. (original name was: 3300029012.a:Ga0169674_100321); c00064_3300029.. (original name was: 3300029012.a:Ga0169674_100462); c00065_3300029.. (original name was: 3300029012.a:Ga0169674_100042); c00066_3300029.. (original name was: 3300029012.a:Ga0169674_100236); c00067_3300029.. (original name was: 3300029012.a:Ga0169674_100361); c00068_3300029.. (original name was: 3300029012.a:Ga0169674_100264); c00069_3300029.. (original name was: 3300029012.a:Ga0169674_100178); c00070_3300029.. (original name was: 3300029012.a:Ga0169674_100275); c00071_3300029.. (original name was: 3300029012.a:Ga0169674_100287); c00072_3300029.. (original name was: 3300029012.a:Ga0169674_100194); c00073_3300029.. (original name was: 3300029012.a:Ga0169674_100291); c00074_3300029.. (original name was: 3300029012.a:Ga0169674_100432); c00075_3300029.. (original name was: 3300029012.a:Ga0169674_100195); c00076_3300029.. (original name was: 3300029012.a:Ga0169674_100292); c00077_3300029.. (original name was: 3300029012.a:Ga0169674_102069); c00078_3300029.. (original name was: 3300029012.a:Ga0169674_101972); c00079_3300029.. (original name was: 3300029012.a:Ga0169674_100323); c00080_3300029.. (original name was: 3300029012.a:Ga0169674_100325); c00081_3300029.. (original name was: 3300029012.a:Ga0169674_100016); c00082_3300029.. (original name was: 3300029012.a:Ga0169674_100404); c00083_3300029.. (original name was: 3300029012.a:Ga0169674_100437); c00084_3300029.. (original name was: 3300029012.a:Ga0169674_102359); c00085_3300029.. (original name was: 3300029012.a:Ga0169674_100322); c00086_3300029.. (original name was: 3300029012.a:Ga0169674_100516); c00087_3300029.. (original name was: 3300029012.a:Ga0169674_101122); c00088_3300029.. (original name was: 3300029012.a:Ga0169674_100637); c00089_3300029.. (original name was: 3300029012.a:Ga0169674_100540); c00090_3300029.. (original name was: 3300029012.a:Ga0169674_100544)

Compact view

c00041_3300029.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 1 - 21,002 nt. (total: 21,002 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg41_10 - Putative Class II

ctg41_9 leader / core peptide: MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG - DhbIVCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg41_9 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1

c00054_3300029.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 26,540 nt. (total: 26,540 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 26540:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg54_3

Search NORINE for peptide: strict or relaxed

AMP-binding (526..919): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

c00058_3300029.. - Region 1 - NRPS

Download region GenBank file

Location: 1 - 22,187 nt. (total: 22,187 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 22187:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg58_6

Search NORINE for peptide: strict or relaxed

AMP-binding (22..421): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLtdgGIsK
Nearest Stachelhaus code:: aeo
Stachelhaus code match:: 60% (weak)

AMP-binding (1035..1423): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmfsGAIfK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 60% (weak)

AMP-binding (2029..2420): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAiTTGgVsK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

c00061_3300029.. - Region 1 - sactipeptide

Download region GenBank file

Location: 1 - 14,031 nt. (total: 14,031 nt) Show pHMM detection rules used

Region on contig edge.

sactipeptide: (subtilosin or thuricin or TIGR04404 or TIGR03973)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Sactipeptides

Sactipeptide predictions

Sactipeptides - No core peptides found.

Sactipeptides

Core peptide predictions

No core peptides found.