3300029406_5 - 4 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

c00010_3300029.. (original name was: 3300029406.a:Ga0242805_100219)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	NRPS	51,692	80,295

c00043_3300029.. (original name was: 3300029406.a:Ga0242805_100608)

Region	Type	From	To	Most similar known cluster		Similarity
Region 43.1	sactipeptide	11,456	31,596

c00080_3300029.. (original name was: 3300029406.a:Ga0242805_100278)

Region	Type	From	To	Most similar known cluster		Similarity
Region 80.1	NRPS	14,545	63,529

c00087_3300029.. (original name was: 3300029406.a:Ga0242805_100034)

Region	Type	From	To	Most similar known cluster		Similarity
Region 87.1	lanthipeptide	37,926	60,607

Region	Type	From	To	Similarity
Region 10.1	NRPS	51,692	80,295
Region 43.1	sactipeptide	11,456	31,596
Region 80.1	NRPS	14,545	63,529
Region 87.1	lanthipeptide	37,926	60,607

No secondary metabolite regions were found in these records:: c00001_3300029.. (original name was: 3300029406.a:Ga0242805_106717); c00002_3300029.. (original name was: 3300029406.a:Ga0242805_105031); c00003_3300029.. (original name was: 3300029406.a:Ga0242805_102954); c00004_3300029.. (original name was: 3300029406.a:Ga0242805_102157); c00005_3300029.. (original name was: 3300029406.a:Ga0242805_100919); c00006_3300029.. (original name was: 3300029406.a:Ga0242805_100693); c00007_3300029.. (original name was: 3300029406.a:Ga0242805_100450); c00008_3300029.. (original name was: 3300029406.a:Ga0242805_106265); c00009_3300029.. (original name was: 3300029406.a:Ga0242805_104303); c00011_3300029.. (original name was: 3300029406.a:Ga0242805_100130); c00012_3300029.. (original name was: 3300029406.a:Ga0242805_102527); c00013_3300029.. (original name was: 3300029406.a:Ga0242805_100123); c00014_3300029.. (original name was: 3300029406.a:Ga0242805_105350); c00015_3300029.. (original name was: 3300029406.a:Ga0242805_100224); c00016_3300029.. (original name was: 3300029406.a:Ga0242805_105388); c00017_3300029.. (original name was: 3300029406.a:Ga0242805_105618); c00018_3300029.. (original name was: 3300029406.a:Ga0242805_104292); c00019_3300029.. (original name was: 3300029406.a:Ga0242805_100160); c00020_3300029.. (original name was: 3300029406.a:Ga0242805_100583); c00021_3300029.. (original name was: 3300029406.a:Ga0242805_103070); c00022_3300029.. (original name was: 3300029406.a:Ga0242805_104255); c00023_3300029.. (original name was: 3300029406.a:Ga0242805_105691); c00024_3300029.. (original name was: 3300029406.a:Ga0242805_100506); c00025_3300029.. (original name was: 3300029406.a:Ga0242805_100556); c00026_3300029.. (original name was: 3300029406.a:Ga0242805_100955); c00027_3300029.. (original name was: 3300029406.a:Ga0242805_101994); c00028_3300029.. (original name was: 3300029406.a:Ga0242805_100667); c00029_3300029.. (original name was: 3300029406.a:Ga0242805_100642); c00030_3300029.. (original name was: 3300029406.a:Ga0242805_100456); c00031_3300029.. (original name was: 3300029406.a:Ga0242805_101745); c00032_3300029.. (original name was: 3300029406.a:Ga0242805_101075); c00033_3300029.. (original name was: 3300029406.a:Ga0242805_101111); c00034_3300029.. (original name was: 3300029406.a:Ga0242805_102252); c00035_3300029.. (original name was: 3300029406.a:Ga0242805_101079); c00036_3300029.. (original name was: 3300029406.a:Ga0242805_101746); c00037_3300029.. (original name was: 3300029406.a:Ga0242805_100591); c00038_3300029.. (original name was: 3300029406.a:Ga0242805_100555); c00039_3300029.. (original name was: 3300029406.a:Ga0242805_100256); c00040_3300029.. (original name was: 3300029406.a:Ga0242805_100832); c00041_3300029.. (original name was: 3300029406.a:Ga0242805_104065); c00042_3300029.. (original name was: 3300029406.a:Ga0242805_103755); c00044_3300029.. (original name was: 3300029406.a:Ga0242805_106948); c00045_3300029.. (original name was: 3300029406.a:Ga0242805_105356); c00046_3300029.. (original name was: 3300029406.a:Ga0242805_104038); c00047_3300029.. (original name was: 3300029406.a:Ga0242805_101206); c00048_3300029.. (original name was: 3300029406.a:Ga0242805_100841); c00049_3300029.. (original name was: 3300029406.a:Ga0242805_101487); c00050_3300029.. (original name was: 3300029406.a:Ga0242805_100212); c00051_3300029.. (original name was: 3300029406.a:Ga0242805_101527); c00052_3300029.. (original name was: 3300029406.a:Ga0242805_106339); c00053_3300029.. (original name was: 3300029406.a:Ga0242805_101217); c00054_3300029.. (original name was: 3300029406.a:Ga0242805_100648); c00055_3300029.. (original name was: 3300029406.a:Ga0242805_107227); c00056_3300029.. (original name was: 3300029406.a:Ga0242805_107068); c00057_3300029.. (original name was: 3300029406.a:Ga0242805_100175); c00058_3300029.. (original name was: 3300029406.a:Ga0242805_100534); c00059_3300029.. (original name was: 3300029406.a:Ga0242805_102538); c00060_3300029.. (original name was: 3300029406.a:Ga0242805_100263); c00061_3300029.. (original name was: 3300029406.a:Ga0242805_101892); c00062_3300029.. (original name was: 3300029406.a:Ga0242805_100668); c00063_3300029.. (original name was: 3300029406.a:Ga0242805_100305); c00064_3300029.. (original name was: 3300029406.a:Ga0242805_100146); c00065_3300029.. (original name was: 3300029406.a:Ga0242805_100162); c00066_3300029.. (original name was: 3300029406.a:Ga0242805_101167); c00067_3300029.. (original name was: 3300029406.a:Ga0242805_101258); c00068_3300029.. (original name was: 3300029406.a:Ga0242805_101617); c00069_3300029.. (original name was: 3300029406.a:Ga0242805_101139); c00070_3300029.. (original name was: 3300029406.a:Ga0242805_101196); c00071_3300029.. (original name was: 3300029406.a:Ga0242805_101443); c00072_3300029.. (original name was: 3300029406.a:Ga0242805_104596); c00073_3300029.. (original name was: 3300029406.a:Ga0242805_101157); c00074_3300029.. (original name was: 3300029406.a:Ga0242805_101920); c00075_3300029.. (original name was: 3300029406.a:Ga0242805_102503); c00076_3300029.. (original name was: 3300029406.a:Ga0242805_100631); c00077_3300029.. (original name was: 3300029406.a:Ga0242805_102603); c00078_3300029.. (original name was: 3300029406.a:Ga0242805_102986); c00079_3300029.. (original name was: 3300029406.a:Ga0242805_103666); c00081_3300029.. (original name was: 3300029406.a:Ga0242805_104029); c00082_3300029.. (original name was: 3300029406.a:Ga0242805_100105); c00083_3300029.. (original name was: 3300029406.a:Ga0242805_104396); c00084_3300029.. (original name was: 3300029406.a:Ga0242805_104586); c00085_3300029.. (original name was: 3300029406.a:Ga0242805_100344); c00086_3300029.. (original name was: 3300029406.a:Ga0242805_105450); c00088_3300029.. (original name was: 3300029406.a:Ga0242805_100357); c00089_3300029.. (original name was: 3300029406.a:Ga0242805_100214); c00090_3300029.. (original name was: 3300029406.a:Ga0242805_100227); c00091_3300029.. (original name was: 3300029406.a:Ga0242805_100909); c00092_3300029.. (original name was: 3300029406.a:Ga0242805_100257); c00093_3300029.. (original name was: 3300029406.a:Ga0242805_100261); c00094_3300029.. (original name was: 3300029406.a:Ga0242805_100287); c00095_3300029.. (original name was: 3300029406.a:Ga0242805_100431); c00096_3300029.. (original name was: 3300029406.a:Ga0242805_100477); c00097_3300029.. (original name was: 3300029406.a:Ga0242805_101109); c00098_3300029.. (original name was: 3300029406.a:Ga0242805_100524); c00099_3300029.. (original name was: 3300029406.a:Ga0242805_100651); c00100_3300029.. (original name was: 3300029406.a:Ga0242805_100259); c00101_3300029.. (original name was: 3300029406.a:Ga0242805_100717); c00102_3300029.. (original name was: 3300029406.a:Ga0242805_100791); c00103_3300029.. (original name was: 3300029406.a:Ga0242805_101244)

Compact view

c00010_3300029.. - Region 1 - NRPS

Download region GenBank file

Location: 51,692 - 80,295 nt. (total: 28,604 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

c00043_3300029.. - Region 1 - sactipeptide

Download region GenBank file

Location: 11,456 - 31,596 nt. (total: 20,141 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or TIGR03973)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Sactipeptides

Sactipeptide predictions

Sactipeptides - No core peptides found.

Sactipeptides

Core peptide predictions

No core peptides found.

c00080_3300029.. - Region 1 - NRPS

Download region GenBank file

Location: 14,545 - 63,529 nt. (total: 48,985 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 14544 - 63529:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg80_37

Search NORINE for peptide: strict or relaxed

AMP-binding (20..419): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLtdgGIsK
Nearest Stachelhaus code:: aeo
Stachelhaus code match:: 60% (weak)

AMP-binding (1033..1421): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmfsGAIfK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 60% (weak)

AMP-binding (2027..2418): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAiTTGgVsK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

c00087_3300029.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 37,926 - 60,607 nt. (total: 22,682 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

Lanthipeptide predictions

Lanthipeptide(s) for ctg87_40 - Putative Class II

ctg87_39 leader / core peptide: MTEEFIGCIEEELKEIELFYEENGVEVEAYTLHNG - DhaFFDhaICC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg87_39 - Class II: Cleavage pHMM score: -6.60; RODEO score: 0; Monoisotopic mass: 769.3 Da; Molecular weight: 769.9 Da; Number of bridges: 2